KEGG   Ricinus communis (castor bean): 8260287Help
Entry
8260287           CDS       T01087                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00630  Glyoxylate and dicarboxylate metabolism
rcu00710  Carbon fixation in photosynthetic organisms
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
rcu01200  Carbon metabolism
Module
rcu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rcu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rcu_M00532  Photorespiration
rcu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    8260287
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8260287
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     8260287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 8260287
NCBI-ProteinID: XP_015581999
Position
Unknown
AA seq 164 aa AA seqDB search
MPAVVSLAAVMNDISIFLISLLQLYSLSLAESLKKMSAGIFTAPVAGSGYHGLKANSTKQ
VFPAKDSSVAWSRKTVSNGSKTYCMKKGYVHRENSRMPGYYDGRYWTLWKLPMFGCNDSS
QVLNEINECKKAYPNAYIRCLAFDNTRQAQCMSFVIQNPKATTH
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagtcgtctctcttgcagcagttatgaatgacattagcatttttcttatttca
ttgctgcagctgtactcactttctttagcagagagtttaaagaagatgtctgccggaatc
tttacagctccggttgctggatctggttaccatggcttgaaagccaactcaacaaaacaa
gtgttccctgccaaagattcttctgttgcatggagccgaaaaactgtctccaatggttcc
aagacttactgcatgaagaaagggtatgtgcatagggagaatagcaggatgccaggatac
tatgatggaaggtactggacactatggaagctccccatgtttggatgcaacgactcatct
caagtgcttaatgaaatcaacgaatgcaaaaaggcatacccaaatgcctatatccgctgc
ttggcatttgataacacccgccaggctcagtgcatgtcctttgtcatccaaaaccctaaa
gctaccactcattga

DBGET integrated database retrieval system