KEGG   Ricinus communis (castor bean): 8263195Help
Entry
8263195           CDS       T01087                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00052  Galactose metabolism
rcu00500  Starch and sucrose metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8263195
   00500 Starch and sucrose metabolism
    8263195
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8263195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 8263195
NCBI-ProteinID: XP_002530338
UniProt: B9SWG9
Position
Un
AA seq 573 aa AA seqDB search
MIGMLKLIAATCSIAFVFLTMAMASGQGSHQRIQAKQVKQLHRTAYHFQPPMHWINDPNG
PMHYNGIYHLFYQYNPKGAIWGNIVWAHSVSKDLINWEALEPAIYPSEWFDIVGCWSGSA
TILPDNKPVILYTGVDPKQRQLQNYAIPKNLSDPYLREWVKPKDNPVVSPDSKVNATAFR
DPTTAWYADGQWRMAVGSRRNDRGVAYLYRSKDFKKWVKAKHPLHAKAETGMWECPDFFP
VALSGEDGVDTSLINQNVKHVLKVSLELTRYEYYTLGIYDKGKDRYYPDSNLVDGWSGLR
YDYGNFYASKTFFDPSKNRRILWGWANESDAEHDDTNKGWAGIQLIPRKLWLDPRGNQLI
QWPIQELETLRGQSVQLTKKHIKKGEYVEVKGITAAQADVDVTFSFPSLDKAEPFDPKWK
NLVAQDICAVKGSKAQGGLGPFGLLTLASENLEEFTPVFFRVFKASDKYKVLLCSDARSS
SLGSGLYRPSFAGFVDVDLADKKLSLRSLIDHSVVESFGAEGRTVVTARVYPTIAIYDKA
HLFAFNNGSETVTVENLKAWSMNRPVMNPPLRK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgataggaatgttaaagcttatagcagcaacatgcagcattgcctttgtcttcttgaca
atggcaatggcaagtggtcagggctctcaccagagaattcaagccaagcaggtcaagcaa
ctccacagaacggcttatcactttcaaccccctatgcactggatcaatgatccaaatggt
cctatgcactacaatggaatataccatctcttctaccaatataatccaaaaggtgcaatt
tggggcaacattgtctgggctcattctgtttctaaggatttgatcaattgggaggctctc
gagcctgcaatttacccttcagaatggtttgatattgtcggatgttggtccgggtccgca
acaatcctgcctgacaataaacccgtaatcctttacactggcgttgacccaaaacagcgt
cagctccaaaactatgccatacccaagaacttgtctgatccgtacctccgcgagtgggtc
aagcccaaagacaatccggtagtatctccggactcaaaagtaaatgctaccgccttccgt
gatccaactactgcttggtatgctgatgggcagtggaggatggcggtgggcagcaggagg
aatgacagaggcgttgcctatttgtataggagcaaggattttaagaagtgggttaaggcc
aagcacccacttcatgcgaaagcggaaactggtatgtgggagtgtccagacttcttccca
gttgcgctatccggtgaagacggggtggatacttcacttattaatcagaatgtgaagcat
gtgttgaaggttagcttggaactgacaagatatgagtactatacgcttggtatttatgat
aagggaaaagataggtattatcctgatagcaatttagttgatggttggagtgggcttaga
tatgattatggcaacttttatgcttccaagactttctttgacccaagcaagaatagaaga
attttgtggggttgggctaatgagtctgatgctgaacatgatgatacgaataaaggatgg
gcaggaattcagctcattccaaggaagctatggcttgatcccagaggaaaccaattaata
caatggccgattcaagaattggagactctaagagggcaaagtgttcaattgaccaaaaaa
catattaaaaagggagaatacgttgaagttaaaggcataactgctgctcaggctgatgtt
gatgttactttctcattcccaagcctagacaaagctgaaccattcgaccctaaatggaag
aaccttgtcgctcaagatatctgtgctgtaaagggatcaaaggctcaaggtggtcttgga
ccattcgggctcttgacactagcctctgaaaatcttgaagaatttactcccgtcttcttc
agagtttttaaagcatcagacaagtataaagttctcctttgctctgatgcaagaagctct
tccttgggaagtggactgtacagaccatcttttgctggttttgttgacgtagatttagct
gacaagaagctttcgcttaggagtttgattgatcactcggtagtagaaagttttggagct
gaaggcagaactgtggtaacagcaagagtatatcctactattgctatctatgacaaggct
catctgttcgcgttcaacaatggttctgaaactgtgacagtggagaatcttaaagcatgg
agcatgaataggcctgtaatgaacccacccctgagaaaataa

DBGET integrated database retrieval system