KEGG   Ricinus communis (castor bean): 8264631Help
Entry
8264631           CDS       T01087                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00130  Ubiquinone and other terpenoid-quinone biosynthesis
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    8264631
Enzymes [BR:rcu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     8264631
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     8264631
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     8264631
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     8264631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_6 Abhydrolase_1 TPP_enzyme_M_2 Hydrolase_4 Abhydrolase_2 TPP_enzyme_C Ndr Abhydrolase_3 BAAT_C Esterase DUF676 DLH Thioesterase DUF2974 Lipase Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 8264631
NCBI-ProteinID: XP_015572025
Position
Unknown
AA seq 1718 aa AA seqDB search
MKPHILLIANYSSISPPLNLQFRVKKSRHSPSFLAFLNRTAPFRFNLLNSKVIMEAVRYD
GPIIDFDELEADKDCEVVIETCITRTLTPALTLEHGLRSVKEAVEELKLNPPASSRGILR
FQVAVPPSPKALNWFLCQPESSGVFPLFFLSKETENVSRKSLYLNRSRGVFGIGAAIYFM
DSSSSMSGEQRRIRRYVSSDSIRIATYGFMDTKFDTLTYSIKNEAGSFYLVVPQIELHEH
EDVSVLSATLAWDDAFFCTFKQAIQSFESSIYQASYHCWPTRDRIHSYCMRSALNKGSLV
KDDTFQMVSSNALFWDRRDQDDLLELRGFCQFFFRLSPTIGVSNNMLDHVGGTNYSWQDY
ANINAVWASLIVEECSRLGLTYFCIAPGSRSSPLAIAASVHPLTTCVACFDERSLAFHAV
GYARGSQKPAVVITSSGTAVSNLLPAVVEASQDFVPLLLLTADRPPELQNAGANQSINQV
NHFGSFVRCFFSLPAPTDSIPARMVLTTLDSAVHWATSSPYGPVHINCPFREPLDDSPDK
WMFSCLKGLDIWMSSAEPFTKYIEMPSSLPCDGDNRIALIQILEIVQRAKRGLLLIAAMH
TEDDIWAALILAKHLNWPVVADILSGLRLRKLLSYFPGVEENILFVDHLDHALLSNFVRG
WMQLDVVIQIGSRITSKRIFQMLEEHYPFSYILVDNHPCRHDPSHFVTHRVDCSILQFVD
SLMKAKLLNRSSEWCGFLSALDRMVAWNISYQIYAENLLTEPHVLRAISEALSSESALFI
GNSMAIRDADMYGCSYENHSCRIADMVLNSELQCLGIQVAGNRGASGIDGLLSTAIGFAV
GCNKRVLSLIGDVSFLHDTNGLSILSTRLPRKPMTVLVINNHGGAIFSLLPIANRIDQRI
LKQYFYTSHNISIQQLCMAHSVRHLLVKTKKELEDALLTSQREQTDRVIEVESSISANSA
FHSTLRKSACQAANHAFTVLSSLSVPFSISDGFFLCKILKMEYSLYRIQLCAPPTSAPVD
LDTNEFHREGYILSLSLEDGSVGCGEVAPIEIHKEDMLDVEEQLRFLLHVIKGTKISFSL
PLLKESFSSWIWNNLGIPENSIFPSVRLGLEMAILNAIAERQGSSLLNIIQPQRGKEEAY
EKSNVKICGLIDSNGSPAEVAYIASSLVKEGFSALKLKVARRLDPIQDAAVIQEVRKKVG
RQIELRVDANRNWSYEEAIQFGSLVKDCNLQYIEEPVQDEDDIIKYCEESGLPVALDETI
DKFCENPLHMLVKYAHPGIVAVVIKPSVVGGFERAALIAEWAHQLGKMAVVSAAFESGLG
LSTYIQFSSYLEVQNADLCRVMDRKLGPPVAHGLGTYQWLKQDVTTKPLRIRHLPCGFIG
ASVSDAIEFVQKFQINQKVICRTFTGEQVSTYDFSVNSKGFACSIKVQEVGQKNDDNVVL
FLHGFLGTGEDWVPIMKAISGSARCISIDLPGHGGSKISNCGAKESNKESALSVELVADL
LYKLIQHLTPGKISLVGYSMGARIALHMALKHEDKISRAVILSGSPGLKDEMSRKFRLAK
DVSRSRLLIVHGLQLFLDAWYAGELWNSLRSHPRFQEIVSSRLSHDDVYSLAEALSGLSI
GRQIPLWEDLKQCNIPLLIIVGEKDEKFKEIAQKMSHEIGQSGEGRGGMGNNIVQIVEVP
NCGHAVHIENPLSVIRALRQFLTRPRKCSTPGHSEEML
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcacatattactaatcgcaaactattcctcaatttcaccgccgctaaatctt
caatttcgcgtcaaaaaatctagacattcaccgtcttttctcgcgtttctcaacagaacc
gctcctttccgcttcaatcttctcaattctaaggttattatggaagcggtgagatatgat
ggaccgataattgattttgacgaattagaagctgataaagattgtgaggtagttatagag
acgtgcattacacgcacgttgactccagcgttgactttagagcacggtcttcgaagtgtt
aaagaagctgtagaggaattgaagttgaatcctcctgcttctagtagaggaattttaaga
tttcaggttgctgtgcctcctagtccaaaggctttgaattggtttttgtgtcaaccggag
tcatctggagtgtttcctttattttttctttctaaggagacagagaatgtatcccgtaaa
tctctttatttgaatagaagccgtggtgtttttggaattggagctgctatttacttcatg
gactcttcttctagtatgtccggggagcagcgacggataagaagatatgtatcaagtgat
tccatccgtatagcaacttatggttttatggatactaaatttgacaccttaacatattcc
attaagaatgaggctggttccttttatcttgtagttcctcagattgaattacatgagcat
gaggatgtctccgtactatcagccacattggcatgggatgatgctttcttttgtacattt
aaacaagcaattcaatcgtttgagtcctctatttaccaggcaagttatcattgttggccg
acaagagacagaatccattcttattgcatgagatctgctctcaataagggctctctggtg
aaggatgatactttccaaatggtttcctcaaatgcactgttttgggacagaagggatcaa
gatgacctcttggaactgagagggttctgtcagttttttttcaggctttcaccaaccatt
ggtgtttccaacaacatgttggatcatgttgggggaacaaattactcctggcaagactat
gcaaacatcaatgcagtttgggcatcacttattgtggaagagtgttctcgtcttgggtta
acgtatttttgcattgctccaggatcaagatcatcgcctcttgccattgctgcatcagtt
catcccctcacaacatgtgttgcatgctttgatgagcgctcacttgcatttcatgctgtt
ggttatgcaagaggttctcaaaaacctgctgttgtcataacatcttcaggaactgctgtt
tcaaatcttcttcctgctgttgtggaagccagtcaagattttgtgcctcttctcttattg
actgcagatcgtcctcctgagcttcaaaatgctggggcaaaccaatcaatcaatcaggtg
aaccattttggctcttttgtgagatgcttcttcagtcttcctgctccaacagatagtatt
cctgcgaggatggtgcttactactcttgactcagctgtacattgggcaacctcttcacca
tatggccctgttcatataaactgtcctttcagagagcccttggatgacagtccagacaaa
tggatgttcagctgtctaaagggattagatatttggatgtctagtgctgagccattcacc
aagtatattgaaatgccaagttcacttccttgcgatggcgataatcgcatagcactaata
caaattcttgaaatagttcaaagggctaaaagagggcttctacttattgctgcaatgcat
acagaagatgatatatgggcggctcttattttggcaaaacatcttaattggccagttgta
gcagacatattgtcaggtttacgtctaagaaagctcttgtcttattttcctggagtagaa
gagaatattttatttgttgatcacctagaccatgctctgctctcaaattttgtcaggggt
tggatgcagttggatgtagttattcagattggaagtcggataacaagcaagcgaattttt
caaatgctggaggagcattatccgttctcatacatcttagttgataatcatccatgccgt
catgatccatctcattttgtaactcatagggtggattgctccattcttcagtttgttgac
agtttaatgaaagctaaacttcttaataggagcagcgaatggtgtggttttttaagtgct
ttagacaggatggttgcatggaacatatcatatcagatttatgcagagaacttgttgact
gagccacatgttcttcgtgcgatttcagaagcactttcatctgagtctgctctttttatt
ggcaacagcatggcaatacgtgatgcagacatgtatggctgtagttatgaaaaccattct
tgtagaattgcagatatggtgctgaactcagaacttcaatgtcttgggattcaggtggct
ggaaaccggggtgctagtggtattgatggtttgcttagcacagcaattggttttgcagtt
ggatgcaataaaagagtactttctttgattggagatgtttctttccttcatgatacaaat
ggcttgtcaatcttgagcacaaggttgccaaggaagccaatgacagtactcgtgataaac
aatcatggtggagcaatcttcagccttcttcctattgcaaatagaattgatcaaagaata
ctgaaacaatatttctatacttcccataacatttcaattcagcagctgtgcatggcacac
agcgtgagacatttactagtgaagactaaaaaggaacttgaagatgctttgctcacatcc
cagcgagagcagacagatcgtgtcattgaagtagagagctccatcagtgctaattcagcc
ttccacagtacattaagaaaatctgcatgccaagcagctaatcatgccttcaccgttctt
tcaagcctttccgttccattttccatctcagatggttttttcctttgcaaaatcctcaaa
atggagtattcattatacagaattcaactatgtgcccctcctacttcagctcctgtagat
cttgatactaatgagttccatagggaaggctacattttgtcgttgtctcttgaagatgga
agtgttggctgtggcgaggttgcacctattgaaattcacaaagaagacatgctggatgta
gaagagcaacttcgatttctccttcatgtaattaaaggaacaaagattagtttttccctt
cctctgctgaaggaatcattttcctcttggatatggaataatttagggatcccggaaaat
tcaatctttcctagtgtcagattgggcttagaaatggctattctcaatgccattgcagaa
agacaaggttccagtttactaaacataatccaaccacagagaggaaaagaagaagcttat
gaaaagtccaacgttaagatatgtggccttattgattctaatgggagtcctgcggaggtt
gcttatattgcttcctctcttgttaaagaaggattttctgcattaaagctaaaagttgca
cgtcggctggatcccattcaagatgctgcagttatacaagaagtaaggaagaaagttggt
agacagattgaacttcgagtagatgcgaatagaaactggtcctatgaagaagctattcaa
tttggttctctcgtgaaagattgtaacctgcagtatattgaggaacccgtgcaggatgaa
gatgatattataaagtactgtgaagagagtggcttacctgtggcacttgatgaaactatt
gacaagttttgtgaaaatccccttcatatgcttgtgaagtatgctcaccctggaatagtt
gctgtggtaattaaaccaagtgttgttggtgggtttgaaagagcagccttaattgccgaa
tgggcacatcaactgggaaagatggctgttgtcagtgctgcatttgaaagtggcctaggt
ctatctacttatattcagttctcctcttacctagaggtgcagaatgcagatctttgcaga
gttatggaccgaaagttggggccacctgtagctcatggtcttggaacttatcaatggctt
aaacaagatgtaacaactaaacctctgaggattcggcatcttccatgtggctttataggt
gcatctgtttctgatgccatagaattcgtgcagaagtttcaaattaaccaaaaggttatt
tgcagaactttcacaggggagcaagtctctacatatgatttttctgtgaattcaaagggt
ttcgcttgctccatcaaagtacaagaggttggacaaaagaatgacgataatgtggtttta
tttctccatggattccttgggactggtgaagactgggtccctatcatgaaggccatctca
ggatcggcaagatgtatttcaattgatcttcctggtcacgggggatcaaaaatatcaaac
tgtggtgctaaagaatccaataaggaatcagctttgtctgttgaattagtcgcagatcta
ttgtataagttgattcaacacctaactcctggaaagatttcccttgttggatattcaatg
ggagcaagaattgcgctgcacatggcactgaaacatgaagataagattagtagagctgtt
atactatctggtagtccaggattaaaagatgagatgtcaagaaaatttcgtcttgctaaa
gatgtctccaggtcacgcttactcattgtccatgggctacaactctttctagatgcctgg
tatgctggagagctatggaacagcttgagaagccatccccgctttcaggaaatagtttcc
agccgcttgtcgcatgatgatgtttatagtcttgcagaagccctgtctggcttgagtatt
ggtaggcagataccattatgggaagacttgaagcaatgtaatattccccttctaatcatt
gtcggggagaaagatgagaagttcaaagaaattgcccaaaaaatgagccatgaaattggc
caatctggcgagggcagaggaggaatgggaaacaacattgttcagatagttgaggttccc
aactgtgggcatgctgtccatatcgagaaccctctatctgttatcagggcattgagacaa
tttctgaccaggccaagaaagtgttctactccagggcacagtgaagagatgctctaa

DBGET integrated database retrieval system