KEGG   Ricinus communis (castor bean): 8264703Help
Entry
8264703           CDS       T01087                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8264703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcu03041]
    8264703
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8264703
Spliceosome [BR:rcu03041]
 Complex C
  Other components
   Step II factors
    8264703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD T2SSE AAA_30 AAA_19 FtsK_SpoIIIE DUF2075 Peptidase_S26 PhoH ATPase ABC_tran
Motif
Other DBs
NCBI-GeneID: 8264703
NCBI-ProteinID: XP_015584572
Position
Unknown
AA seq 715 aa AA seqDB search
MPSMAEKTPPSLKPHSNADSLARRERIRMQRESLPIASVRERLVEEVKSHDILIIVGETG
SGKTTQLPQFLLNAGFCRDGKVIAITQPRRVAAVTVAKRVAEECGVELGQKVGYSIRFDD
ATSTSTKIKYMTDGLLLREALLDPYLSRYSVIIIDEAHERTVHTDVLLGLLKNVQYARSK
SVSNQKTIDDGRVSNGSLKENETDTRGINSLKQCQGRKLPPLKLIIMSASLDARVFSEYF
GGARAVHIEGRLHQVDILYTVHPEKDYLDAALMTLFQIHLEEAPGDVLVFLTGQEEIESV
ERLVQEKLQQLPEAKRKLLTVPIFSSLPSEQQMRVFMPTPPGHRKVILATNIAETSVTIP
GIKYVIDPGLVKARSYDPVKGMESLVVVPTSKAQALQRSGRAGREGPGKCFRLYPEREFE
KLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFIEKPSRAAIIKSLEHLFLLGALTDE
CKLSDPVGHQMARLPLDPIYSKALILASQFNCLEEMLITVAMLSVESIFYAPREKSEESR
TAMKCFSSPDGDHLTLISVYRAADELLEKRKMELNNEKNFKGKGEKILRKWCKENFINGR
SLRHARDIHSQIRGHVEQMGLRVSSCGDDMLQFRRCLAASFFLNAALKQPDGTYRALASG
QTVQIHPFSVLFRSKAECVIFNELVQTSKKYIRNITRIDYLWLTELAPHYYAMQS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatggccgagaagactcctccttcccttaaacctcactccaatgctgattct
cttgctaggagagaaagaattagaatgcagagagaatctctaccaattgcttcagttagg
gaacgacttgtcgaagaagttaaatcacacgatattctaattatcgttggtgaaaccgga
agtggcaaaactactcaattacctcagtttctattgaacgctggattctgtcgcgacgga
aaagtaattgctataactcaaccgaggcgtgttgctgctgtcactgtggctaaacgtgtt
gcagaagaatgtggtgttgaattaggtcaaaaagttggttactctattagatttgatgat
gcaacttctacttctactaaaattaagtacatgactgatggattgcttcttagggaagct
ttattggatccttacctctctcgatattctgtcatcattattgatgaagctcatgaaaga
actgtccacactgatgtgttactaggcttgcttaaaaatgtacaatatgcaaggtcaaaa
tctgttagtaaccaaaaaactattgatgatggtagggtaagtaatggctcattgaaggag
aacgaaactgatacccgaggcattaattctcttaagcaatgccaaggtagaaaattacct
ccattgaagttaatcatcatgtctgctagcttggatgcacgtgtattttctgagtacttt
ggtggtgccagagctgttcatattgaagggcgcctacatcaagttgatatactctataca
gttcatcctgaaaaagattacctcgatgcagccttgatgactctattccagattcacttg
gaagaggcccccggtgacgtacttgtatttctgactgggcaagaagagatcgaatcagtt
gaaagacttgtgcaggagaaacttcaacagttacctgaagccaaacggaagttattaaca
gttcccatattttcatctcttccatcagagcagcaaatgcgagttttcatgccaactcca
cctggccatcgtaaggtaatattggcaacaaatattgctgagacatcagttacaatacct
ggaatcaagtatgttatagatcctggattagtaaaagctcgttcctatgatccagtcaaa
ggaatggaatcacttgtagtagttccaacatcaaaggctcaggctcttcaaaggagtgga
cgtgcagggcgtgaaggacctgggaagtgctttcgtctctatccagagagggaatttgag
aaacttgaggattcaacaaagccagagatcaagcggtgcaacctctcaaatgtcatcttg
cagctgaaggctctaggtgttgatgatattattgggtttgatttcatagagaaaccatct
agggcagctatcatcaaatcgttggaacatttatttctgctgggtgctctgacagatgaa
tgtaagctgtctgatcctgttgggcatcaaatggctcggcttcccttggatcctatttat
tccaaagccctcatcctagctagtcagttcaactgcttggaagaaatgctaataactgtt
gcaatgctctcagtggaatctatcttttatgcccctcgtgagaagtcagaagagtcaaga
acagcaatgaagtgcttttcaagtccagatggagaccaccttacgttgattagtgtatat
cgagcagcagatgagcttttggaaaaaagaaagatggaactcaataatgaaaagaatttc
aaagggaaaggtgaaaaaattctgagaaaatggtgcaaggaaaatttcattaatggtcgt
tccctaaggcatgctcgtgacattcacagtcaaattcgtggacatgttgaacaaatgggt
cttcgtgtttcttcttgtggagacgacatgcttcagttccgcagatgccttgctgcttcc
tttttccttaatgcagctttgaagcagcctgatgggacatacagggcgttggcaagtggt
cagacagtgcagattcatcctttttccgtgttgtttcgttcaaaggctgagtgcgtaatt
ttcaatgaattagtccagacttctaagaagtacatccgaaacataactagaattgactat
ttgtggttaactgaacttgctccgcactattacgctatgcagagttaa

DBGET integrated database retrieval system