KEGG   Ricinus communis (castor bean): 8264805Help
Entry
8264805           CDS       T01087                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8264805
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     8264805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase GDPD VEG
Motif
Other DBs
NCBI-GeneID: 8264805
NCBI-ProteinID: XP_015578389
Position
Unknown
AA seq 319 aa AA seqDB search
MPFFLSLNSSHFTACRIKFNHVRSRFLTVESRADMAAASSTVRVAAAQMTSINDVAANFA
TCSRLVKEAAAAGAKLLCLPESFSFIGARDGDSIKIAEPLDGPIMQQYCSLARESDIWLS
LGGFQERGSDDAHLRNTHVIIDDCGNIRSTYPKIFLFDVDVPGGRVYKESSFTEAGKNIV
AVDSPVGRLGLSVCYDLRFPELYQQLRFQHEAQILLVPAAFTKITGQAHWEILLRARAIE
TQCYVIAAAQAGNHNEKRESYGDTLIIDPWGTVVGRLPDRLSTGITVADIDISLIDSVRA
KIPIAQQRKPSDFWNSSSL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccattttttctctcactcaactcttcacacttcactgcttgtcgtatcaaattcaat
cacgtgcgttcccgctttttgaccgttgagtcacgtgccgacatggcagcggcctcctct
accgtccgagtcgctgctgctcagatgacgtcaattaacgacgtcgccgccaatttcgct
acttgctctcgtcttgtcaaagaagcagcagctgcaggtgcaaaattgctatgtttacca
gaaagtttctcatttattggggctagagatggagacagtattaagatcgcagaaccattg
gatggtcccattatgcagcaatattgctctctagccagagagtctgatatatggttgtcg
cttggaggatttcaagaaagaggatctgacgatgcacacctacgaaacacgcatgtcatc
attgatgattgtgggaatatcagaagcacttacccgaaaatattcttgtttgatgttgat
gttcctggtgggagggtatacaaagaaagcagctttacagaagctggaaagaatatagtt
gcagttgacagccctgttggacgcttgggtctgtctgtatgttatgatttaaggttccca
gagctttaccagcagctcaggttccagcatgaagcacagattctattggtgcctgcagct
ttcacaaaaataactggtcaagcacactgggagatcctgcttcgagctcgtgcaattgag
actcaatgctatgtaatagctgctgcacaagctggaaaccacaatgaaaaaagagagagc
tatggtgacacattaattattgatccttggggaacggtagttggtagattgccggatcga
ctttcaactgggattactgtggctgatattgatatttcattgatcgactctgtgagagca
aagataccaattgcccagcaacgaaagccttcagatttctggaattcttcatctctgtga

DBGET integrated database retrieval system