KEGG   Ricinus communis (castor bean): 8265956Help
Entry
8265956           CDS       T01087                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03040  Spliceosome
rcu04141  Protein processing in endoplasmic reticulum
rcu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8265956
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8265956
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8265956
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rcu01009]
    8265956
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcu03041]
    8265956
   03009 Ribosome biogenesis [BR:rcu03009]
    8265956
   03110 Chaperones and folding catalysts [BR:rcu03110]
    8265956
   04131 Membrane trafficking [BR:rcu04131]
    8265956
   03051 Proteasome [BR:rcu03051]
    8265956
   03029 Mitochondrial biogenesis [BR:rcu03029]
    8265956
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcu04147]
    8265956
Protein phosphatases and associated proteins [BR:rcu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     8265956
Spliceosome [BR:rcu03041]
 Complex B
  Other components
   Prp19 complex
    8265956
 Complex C
   Prp19-CDC5 complex
    8265956
Ribosome biogenesis [BR:rcu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    8265956
Chaperones and folding catalysts [BR:rcu03110]
 Heat shock proteins
  HSP70 / DNAK
   8265956
Membrane trafficking [BR:rcu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    8265956
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    8265956
Proteasome [BR:rcu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    8265956
Mitochondrial biogenesis [BR:rcu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    8265956
Exosome [BR:rcu04147]
 Exosomal proteins
  Proteins found in most exosomes
   8265956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 8265956
NCBI-ProteinID: XP_002528432
UniProt: B9SR13
Position
Unknown
AA seq 649 aa AA seqDB search
MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA
EEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KIDAKNALENYAYNMRNTVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQLAEADEFED
KMKELESICNPIIAKMYQGAGGPDMGGGMDEDVPPAGGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagacggaccagcgatcgggatagatctcgggacgacgtactcatgc
gtcggagtttggcagcatgacagagtggagatcattgctaatgatcaagggaacagaacg
acgccatcttatgttgcttttactgatacggagcgtttaattggtgacgctgctaaaaat
caggtcgccatgaaccctgtcaacaccgtctttgatgcaaagcgtttgattggtaggaga
tacagtgatgcttctgtacagagtgacataaagctttggccttttaaggttattgctggt
cctggtgataagcccatgattgttgttgcatacaagggtgaagagaaacaattttctgct
gaggagatttcttctatggtcctaattaaaatgcgggagattgctgaggcttatcttgga
ttaacaataaagaatgcagttgtgaccgttcctgcttatttcaatgactctcagcgtcaa
gcgaccaaggatgctggggttattgctggccttaatgttatgcgtattatcaatgagcca
actgctgctgctattgcttatggtcttgataagaaggcaagcagtgctggtgagaagaat
gtattgatctttgatttgggtggtggtacgttcgatgtctcattgcttaccatcgaagag
ggtatctttgaagtgaaggccacagctggtgatactcatcttggtggtgaggattttgat
aacagaatggttaatcactttgtgcaagagtttaagaggaagcacaagaaggatatctct
gggaaccctagagctcttaggcggttgcgaactgcatgtgaaagggctaagaggactctc
tcatctactgctcagacaactatcgagattgattctttgtacgagggtgttgatttctat
acaactattacccgtgctagattcgaggagcttaacatggatctcttcaggaagtgtatg
gagcctgttgagaagtgtttgagggatgctaaaatggacaaaagcagtgtagatgatgtt
gttcttgttggtggttctactagaattcctaaggtgcagcaattgttgcaggacttcttt
aatgggaaggagctttgcaagagcataaaccctgatgaggctgttgcctacggggctgct
gttcaggcagcaattttaagtggcgagggcaatgagaaggtgcaagatttgctgctcttg
gatgttactcccttgtctcttgggctggaaactgctggaggtgttatgactgttttaata
ccaaggaataccaccattcccacaaagaaggagcaggtgttctctacctactctgacaac
cagcctggtgtcttgatccaggtttatgagggtgagagagcaaggactagggacaacaac
ttacttgggaaatttgagctatctggcattcctccggcaccaagaggtgttcctcagatc
actgtgtgctttgacattgacgctaatggtatcttaaatgtctctgccgaggacaagacc
actggccagaagaacaagattaccatcacaaatgataaaggaagattatccaaggaagag
atagagaagatggtacaggaggctgagaagtacaaggctgaggatgaggagcataaaaag
aagattgatgccaagaatgctttggagaactacgcctacaacatgaggaacactgtgaag
gatgagaagatcagctccaaactttccccagatgacaagaagaagattgaggatgccatt
gaacaggctatccaatggttagatgccaatcagctcgctgaggcggacgagttcgaggac
aagatgaaggagctggagagcatttgcaaccctatcattgccaagatgtaccagggtgct
ggtggtccagacatgggaggtggtatggatgaagatgtccctccagctggtggcagtggt
gctggccctaagattgaagaagttgattaa

DBGET integrated database retrieval system