KEGG   Ricinus communis (castor bean): 8267324Help
Entry
8267324           CDS       T01087                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP21-4
  KO
K12736  peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcu03041]
    8267324
   03110 Chaperones and folding catalysts [BR:rcu03110]
    8267324
Enzymes [BR:rcu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     8267324
Spliceosome [BR:rcu03041]
 Complex C
  Other components
   PPlases
    8267324
Chaperones and folding catalysts [BR:rcu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    8267324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Comm
Motif
Other DBs
NCBI-GeneID: 8267324
NCBI-ProteinID: XP_015572340
Position
Unknown
AA seq 234 aa AA seqDB search
MARIKPQALLLQSKKKKAPSRISPVTIILCSLIILLSLFFLYSTYRHWSLRSRLQSESVN
SGFEGDNAFARTKKSDLPKYAVLNTSKGFITVELFKDGSFDVVDKFIDLCKSGHFKQMPF
RHVIKHYVIQAGDADNHGAAEDWTLKGKRYSQLDTSLKHEAFMLGTSKAKHDEKTFELFI
TTAPIPDLTEKLIVFGRVVKGEDVVQEIEEVDTDEYFKPKSHIKIINVTLKDEI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggatcaaacctcaagcacttctgctacaaagcaaaaagaagaaagcaccgagt
cgaataagccccgttactataatcctttgctcattaattattttattatctctctttttc
ttgtattctacatacagacactggtccttaaggtcaagactccaatctgaaagtgtcaac
tcaggctttgagggtgacaatgcttttgcgagaacaaagaagtctgatctcccaaaatat
gcagttttgaatacatccaaaggctttataacagtggaacttttcaaggatggatctttt
gatgttgttgacaagttcattgacttgtgtaaaagtgggcacttcaagcagatgcctttt
cgtcatgtcataaagcattatgtgattcaagcaggggatgctgataatcatggggctgca
gaagattggactttgaaggggaagcgttacagtcaactcgatacaagtttgaagcatgag
gcattcatgctcggaacttccaaggcaaaacatgatgagaaaacatttgagctcttcatt
acaactgcaccaatcccggatctgactgagaagttgatagtttttggacgggtcgttaaa
ggagaagatgttgttcaggaaattgaagaggtggatacagatgaatattttaagcctaaa
tctcatataaagatcatcaatgtgactctaaaggacgaaatctga

DBGET integrated database retrieval system