KEGG   Ricinus communis (castor bean): 8268663Help
Entry
8268663           CDS       T01087                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8268663
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcu03041]
    8268663
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8268663
Spliceosome [BR:rcu03041]
 Complex C
  Other components
   Step II factors
    8268663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_19 AAA_22 AAA_30 S1 DUF2075 T2SSE AAA Flavi_DEAD AAA_14 AAA_24 PhoH RsgA_GTPase SRP54 AAA_16 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 8268663
NCBI-ProteinID: XP_002532676
UniProt: B9T357
Position
Unknown
AA seq 1031 aa AA seqDB search
MATDLNKLEYLSLVSKICSDLETHLGFADKELAEFVIHLGRNSDTFHQFDSKLKRNGAQW
PDYLVRTFITAIHSILPPPKSEGGRIGSAVYRGRVSRVMAKGCFVQLDGDDDFGGKEGLL
HQSDFLVGKEVRRGDEVYVKVVSDSPGQKGLRLSMKDVVDRNTIGEERNTIGEDLGLCKM
ERGLSKTGVSGIHIEEAYYDAKTRMVKMERMNSPDRYDVNQLIASGVLGLSEYPISQEDD
DDPNVEQGIEIELNDDEPAFLHGKTSHSSGIDMSPVKIMKNPDGSLCRSAALQSALMKER
REIIEEKMRRMVDCIPKDLNRSWEDPIPEIGDRCLAQEIRGVDLSAFNMPKWKKDAFQKS
FTFGLRPKLSFQEQRHSLPIYKLKKELIQAVLDNQVLVVIGETGSGKTTQITQYLAEAGY
TAGGKIACTQPRRVAAISVAKRVAEEVGCRLGEEVGYAIRFEDCTGPDTVIKYMTEGLLL
REILTDKNLSQYSVIMLDEAHERTTYTDVLFGLLKQLLKRRCDLRLIVTSATLDAEKFSG
YFFDCNIFTIPGRSFPVEILYTKQPENDYLGAALITVLQIHLTEPEGDILLFLTGQEEID
CACESLDMKMKELGKDVPELIILPVYSALPGEMQSMIFEPAPQGKRKVVVATNIAETSLT
IDGIFYVVDPGFMKQNLYNPKIGVDSLLVTPISQASAKQRAGRAGRTGPGKCYRLYTESA
FRNEMSPATTPEIQRIDLAYPTLTLMAMGIRDLFSFDFMDPPSSQALISAMQQLYGLGAL
DYEGLLTKTGRLMAEFPLEPPLSKMLLASIDLGCSDEILTIIAMIQTGNIFYRPKKKQAQ
ADQRRANFLHSEGDHLTLLAVYADWKEKGFSAPWCSENFLQYRSLKRAQDVRKQLLTIMD
KYKLDVVSAGKDSTKIRKAIAAGFFFHAARRDPQGGYRTLVSDQTVYIHPSSALFQIQPV
WVIYHEVVMTRKEYMHEITAIQPTWLVELAPRLFKASDLMKMSKHKRQERIEPLYDRYHE
PNSWRLSKRRA
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atggctacggatttgaataaattagaatacctttcactagtatctaagatttgttctgat
cttgaaactcaccttgggtttgctgacaaagaattggccgaatttgttattcatttgggt
cgtaattctgatactttccatcaatttgattctaaattgaagcgaaatggtgctcaatgg
cctgactatttggtcagaactttcatcactgccattcattccattcttcctccgcccaaa
tcagagggtggtagaattgggagtgctgtctacaggggtagggtttcaagagtcatggct
aaaggatgctttgttcaattggatggtgatgatgactttggagggaaagagggtttgctt
catcaatctgattttttggttgggaaagaggttaggagaggggatgaggtttatgtgaaa
gttgtttctgattctcctggtcaaaaaggattgaggctttctatgaaggatgttgtcgat
cggaatactattggtgaggagcggaatacaattggtgaggatttgggattgtgcaagatg
gaaagaggcttgagtaagactggtgttagcggaattcatatagaggaggcctattatgat
gctaaaacaaggatggtaaagatggagagaatgaattctccagataggtatgatgtgaat
cagctgattgcttcaggtgttttgggtttgagtgagtatccaattagtcaagaggatgat
gatgatcctaacgttgagcaagggattgagatagagttgaatgatgatgagccagcattt
ttgcatgggaagacgagtcatagtagtggtattgatatgtcgcctgtgaagattatgaag
aatccagatgggtcattgtgtcgttcagccgcacttcagtctgccctcatgaaggaacga
agagagataatagaagagaagatgaggaggatggttgattgcatacccaaggatcttaat
cgttcttgggaagacccaattccagagattggagacaggtgtttggcacaggagatcaga
ggtgttgatttatctgcatttaacatgccaaagtggaagaaggatgcatttcagaagtca
tttacttttgggctgaggccgaagttatcttttcaggaacagaggcatagcttgccaatt
tacaagttgaagaaggaattaattcaagctgtgcttgataatcaggtgcttgtggtgatt
ggtgagactggttcagggaagactactcagataacccagtatcttgcggaggctggatac
acagctggagggaagattgcgtgtacacagcctcggagggtagctgcaatttctgtagcg
aagagggtagctgaagaggttggatgccgtttaggagaggaagttggttatgctattcgc
tttgaggattgcactggacctgatactgtgatcaaatatatgacagagggtttacttctc
agggaaattttgacagacaagaatctgtctcagtactctgtcataatgcttgatgaggct
catgagaggacaacttacactgatgttcttttcggcctgctgaagcagcttttgaaaagg
agatgtgatcttcgtctgattgtcacatctgcgacacttgatgcagaaaaattttctggt
tatttctttgactgcaacattttcactatccctggaagatcttttcctgtggagatatta
tataccaaacagccagaaaatgattacctcggtgcagctcttataacagtcctgcaaatc
cacttgacagaacctgaaggagacattctcctctttttgacaggccaagaagaaatagat
tgcgcttgtgagtcactcgatatgaagatgaaagaactaggtaaagatgttccagagttg
attatcttgccggtttatagtgcacttccaggtgaaatgcaatcaatgatatttgaacca
gctccacaagggaagcggaaagtggttgtggcaaccaatattgctgagacatctttgaca
attgatggaattttttatgttgttgatcctggatttatgaaacaaaatctatataatcca
aagataggggttgattctctgcttgtaacccctatttcacaagcatcagccaaacaacgt
gctggacgtgctgggcgtactggccctggaaagtgttaccgtctatacactgagagtgca
tttcgcaatgagatgtcccctgccacaactccagaaattcaaaggattgaccttgcgtat
cctacactcaccttgatggccatgggaattagagacctcttctcttttgattttatggat
ccaccttcatcccaagccctcatttctgctatgcaacaactctatggtctaggggctctt
gattatgagggacttctaacaaaaacagggaggctaatggctgagtttcctcttgaacca
ccattatctaaaatgttgttggctagtatagaccttgggtgcagtgatgagattttgact
attattgccatgatacagactggtaacattttctaccggcctaagaagaaacaagctcaa
gcagatcaaaggagggctaactttctccattcagaaggagatcatctgactttacttgct
gtgtatgcggactggaaagaaaagggtttctcggcaccttggtgttctgagaattttctt
caatatcgatctttgaagagggcacaggatgtcaggaaacagcttttgaccatcatggat
aaatataagttggatgttgtcagtgctggaaaggattctactaagataagaaaagctatt
gcagcaggattctttttccacgcagctagaagggatccacaggggggttatcggacccta
gttagcgaccagactgtttatatccaccctagcagtgcacttttccagatacaaccagtt
tgggttatctatcatgaggtggtaatgacaaggaaggagtacatgcatgagattactgcc
atacagcctacatggcttgtagagctggcaccgagattatttaaagcctcagatctaatg
aagatgagcaagcacaaacgccaagaacgaattgaaccactttatgatagatatcatgaa
cctaattcatggcgcctcagtaaaaggcgagcttaa

DBGET integrated database retrieval system