KEGG   Ricinus communis (castor bean): 8269653Help
Entry
8269653           CDS       T01087                                 

Definition
(RefSeq) probably inactive leucine-rich repeat receptor-like protein kinase At5g48380
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcu01001]
    8269653
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8269653
Protein kinases [BR:rcu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   8269653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 8269653
NCBI-ProteinID: XP_002529087
Position
Unknown
AA seq 383 aa AA seqDB search
MEARIGETFGIGFLIGYIFSLVVVVVIFMPYCMPREHAVKKRNRVMKTPMMTSLMERREK
RREEAILEISKLEESVTRLSFRMLYDATDSFCQDNVVGVGKMGTMYKGMLPSGCFIAVKR
LNKSQYLEKGFISQLIILSRLRHINMVPFLGFCIESRERLLLCYKYISNGKLYDWLHPVE
GGASFLEWPTRTFIAMKVAKGLIYLHNNCQFPIAHLNLSSSCILLDKNFEPKTSNFGGAV
FISKNSRNFFENVLKQDVYRFGILLLELITGEDPVRNNESFHSLKQTLVEQNAHHSTSSF
SSLCHVVDVSLIGQGFDLEILHCLRVACGCLQTLPDQRPTMTEVYNELLVFKILGVGHIT
ACRNADGTELEMPRCSETVHLQL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaggatcggggaaacatttgggattggctttttaatcggttatatattttct
ttagttgtagtcgtagttattttcatgccatattgcatgcctcgggaacatgctgtcaag
aagaggaacagggtgatgaagacaccgatgatgacatccttaatggaaaggcgtgagaag
aggagagaagaagctattctagagatttccaagttagaggagtcggttacacgattaagt
ttcagaatgctatatgatgcaacagatagtttttgccaagacaatgttgttggggtcgga
aaaatggggacaatgtacaaaggaatgctccctagtggttgttttattgcagttaaaaga
ctaaacaaatctcagtatttggagaaaggcttcatttcccagttgataatcctgagtaga
ttgagacatattaacatggtccccttcttgggtttctgtatagagtcaagagagaggctt
ttgttgtgctacaaatatatatcaaatggcaagctttatgactggctacatcctgtagaa
ggtggagctagcttcctggaatggccaacaaggaccttcattgctatgaaagttgcgaaa
ggactgatatatctccataacaactgccagtttccaatcgcacatcttaacttaagctcg
agttgcatcttacttgataagaattttgaacccaagacatcaaatttcggaggtgcagtc
ttcattagcaaaaattccagaaacttctttgagaatgttctcaagcaggatgtttataga
tttggcattctacttcttgagcttataaccggagaagatcctgtcagaaataatgaatct
tttcactctctcaaacaaactttggttgaacagaatgctcatcattcgactagttcattt
tctagcctatgtcatgttgtcgatgtttctctaattggtcaaggattcgatcttgaaatc
ttgcattgtctaagagttgcttgtggatgtcttcagacacttccagatcaaaggccaaca
atgaccgaagtgtataatgaattgttggtctttaagatattgggtgtcgggcatattact
gcatgccgaaatgctgatggcacagagctagagatgccgaggtgctctgaaacagtacat
ttacaattgtag

DBGET integrated database retrieval system