KEGG   Ricinus communis (castor bean): 8272082Help
Entry
8272082           CDS       T01087                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00010  Glycolysis / Gluconeogenesis
rcu00562  Inositol phosphate metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8272082
   00562 Inositol phosphate metabolism
    8272082
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     8272082
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     8272082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8272082
NCBI-ProteinID: XP_002520778
UniProt: B9S459
Position
Unknown
AA seq 493 aa AA seqDB search
MKKITIISLIIFNLSIIIADQSINIHQHLSTVTRYGAVKDVVYNSFEESNVPDGCTPIHL
NLVARHGTRSPTKKRKRELDRLSSRLEELIRDAEEQKLSLQKVPAWLKGWESPWKGELKG
GELISRGEEELYDLGIRTRERFPDLFKEEYHPDVYPIKATQVPRASASAVAFGIGLFSDK
GSLGRGNHRAFSISSESRASDILLRFHDCCENYKAFRKSQEPAVDKLKEPILDEITAALR
SRYELNFTRKDTSSFWFLCKQEASLLDITDQACGLFTSSEVALLEWTDDLEVFILKGYGK
AINYRMGVPLLKDVFQSMEQAIKAREEKHAPGSYEKARLRFAHAETLIPFTCLLGLFLDG
SEFQKIQKEQPLELPPRPPHNRNWWGSIVAPFAGNNMLVLHSCPADSSSKYFVQVLHNEH
PIPMPGCNNSDFCPFEVFKETIVAPHIKHEFNAVCAVKLEEPEQKPETSKLSQLFRWLFS
LGTDDTQHSGVEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagataacgataattagtttgatcatttttaacttatcaattatcatcgccgat
cagtccattaatatccatcagcatctctccactgttacaagatatggtgccgttaaagat
gtggtttataattcgtttgaggagtctaatgttcctgatggatgcactcctatacactta
aatcttgtggcaagacatggaactcgttctcctaccaaaaaacggaagagggagttggac
cgcttgtcctctcgtttggaagaacttataagagatgctgaagaacagaagttgtctttg
cagaaagttcctgcctggttaaaaggttgggaatctccttggaagggggaactgaaaggt
ggagaattaattagcagaggggaagaagaattatatgatcttggaatcaggaccagagaa
cgatttccggatttgttcaaagaggaatatcaccccgatgtgtatccaataaaggctaca
caggttcctcgggcatcagctagtgctgtggcatttggcattgggctctttagtgataag
ggaagtcttggacgagggaatcatcgagcattctccattagcagtgaaagccgtgcaagt
gatatattgcttaggtttcatgattgttgtgaaaactacaaggcttttaggaaaagccaa
gagccagctgttgataagcttaaggaacctatcttggacgaaattacagctgcattgagg
agtcgttatgaacttaattttacaaggaaggatacttcttctttctggtttctttgtaaa
caggaggcatccttgttggatataaccgatcaagcttgtggtcttttcacttcttctgag
gtggctttgctggagtggacagatgacttggaggtgtttatactgaagggatatggtaaa
gcaataaactacaggatgggagtgccactgcttaaagatgttttccagtccatggagcaa
gctatcaaggcacgagaagaaaaacatgctcccggaagttatgaaaaggcaagactacga
tttgcacatgcagagactctgattccttttacttgtctgctaggtcttttccttgatgga
tctgagttccagaaaatacaaaaggaacaacctttggaacttccgccaagacctccccat
aacagaaattggtggggcagcattgtggcaccttttgctggcaacaacatgctggtcctg
cacagttgtccagcagactcttcaagcaagtactttgtccaagtactccacaatgaacat
cccattccaatgccgggttgcaataattctgatttttgtccctttgaagtgtttaaggaa
acgatagttgctcctcatataaagcacgaatttaatgcagtctgcgcggttaagctggag
gaaccagagcagaagcctgaaaccagtaagttatcacaactgttccgttggctcttctcg
ctggggacagatgatacacagcattcaggagttgaattatag

DBGET integrated database retrieval system