KEGG   Ricinus communis (castor bean): 8274130Help
Entry
8274130           CDS       T01087                                 

Definition
(RefSeq) biotin--protein ligase 2 isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00780  Biotin metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    8274130
Enzymes [BR:rcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     8274130
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     8274130
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     8274130
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     8274130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C GASA
Motif
Other DBs
NCBI-GeneID: 8274130
NCBI-ProteinID: XP_015571534
Position
Unknown
AA seq 361 aa AA seqDB search
MLLLHNCLRFITCVPSGSLGSQPHSPLYRSLASMDNSICTLLLSGKSTAENEIAQSLKQN
GSSIKLPDNTRVSLLLESEISEPEKEASFDRQLFFNNLSTNQFGRLLIWSPRLTSTHDVV
SHNFSELPIGTVCVADIQSKGRGRSKNVWESPKGCLLFSFSVQMEDGRVVPLLQYVVSLA
VTEAIKDICHKKGLPFLDVKIKWPNDLYLNGLKVGGILCTSTYKSKKFNVSAGIGLNVDN
EKPTTCLNAVQRELSPAASQLRREEILTAFFNKFESLYDLFLNQGFQSLEELYYRTWLHS
GQRVIVQENSGDQMVENVVTIQGLTSSGYLLAIGENNVMCELHPDGNSFDFFKGLVRRKL
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctactacttcataattgcctacgttttattacttgtgtaccgtctggctctctaggc
agccagccgcactctcctctctatcgatcattagcatcaatggataattcaatttgtacg
ctattattatcaggaaaatccacagcagagaatgaaatcgctcaatctctgaagcaaaat
ggcagctctataaaactccctgacaacacccgagtatctttactcttggaatcagagatt
tccgagccggaaaaagaagcttctttcgatcgtcaacttttctttaacaacctttcaact
aatcaattcggtcggttacttatttggtctccgcgcttaacttccacgcacgatgtcgtc
tcacacaatttctccgagcttccaattggtactgtttgtgttgctgatattcagtctaaa
ggaagaggtcgctcgaagaacgtgtgggaatctccaaagggatgcctattgttttctttc
agtgttcagatggaggacggccgtgttgtgcctttgttgcaatatgtagtttctctagca
gttactgaggcaataaaagatatttgtcacaaaaaaggcttaccatttctagatgttaaa
ataaaatggccaaatgacctttacttaaatggcctaaaagttggcggcatcctatgcact
tcaacgtataaatcaaagaagttcaatgtcagtgctggtataggtttgaacgttgataat
gagaaaccaacaacatgcttgaatgcagtacaaagagaattgtctcctgctgcttcacaa
ttaagaagagaagaaattctcactgcattctttaacaaatttgaaagtctctatgatctt
ttcttaaatcaaggattccaatctcttgaggagctgtattacagaacatggctacacagt
gggcagagagtcatcgtacaagaaaacagtggggatcaaatggtggagaatgtggttact
attcagggattgacatcctcaggatatttgctagctattggtgaaaacaatgtgatgtgt
gaacttcatcctgatggcaatagttttgacttcttcaaaggactagtcagaaggaaactg
gaatga

DBGET integrated database retrieval system