KEGG   Ricinus communis (castor bean): 8275727Help
Entry
8275727           CDS       T01087                                 

Definition
(RefSeq) cyclin-dependent kinase D-3
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03022  Basal transcription factors
rcu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    8275727
  09124 Replication and repair
   03420 Nucleotide excision repair
    8275727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcu01001]
    8275727
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rcu03021]
    8275727
   03019 Messenger RNA biogenesis [BR:rcu03019]
    8275727
   03400 DNA repair and recombination proteins [BR:rcu03400]
    8275727
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     8275727
    2.7.11.23  [RNA-polymerase]-subunit kinase
     8275727
Protein kinases [BR:rcu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   8275727
Transcription machinery [BR:rcu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     8275727
Messenger RNA biogenesis [BR:rcu03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     8275727
DNA repair and recombination proteins [BR:rcu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     8275727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 8275727
NCBI-ProteinID: XP_002532521
Position
Unknown
AA seq 417 aa AA seqDB search
MSENDGEKKVADRYLKREILGEGTYGVVYKAIDTKTGQTVAIKKIRLGKQKEGVNFTALR
EIKLLKEIKDPNIIELIDAFPHKGNLHLVFEFMETDLEAVIRDRNIFLSPADIKSYFQMT
LKGLAVCHKKWVLHRDMKPNNLLIAPNGQLKLADFGLARIFGSPDRKFTHQVFARWYRAP
ELLFGTKQYGAGVDVWAAACIFAELLLRRPFLQGSSDIDQLGKIFQAFGTPSPSQWPDLV
YLPDYVEYQSVPAQPWRKLFPMASDDALDLLIKMFTYDPKARITAEQALEHRYFSSAPLP
TEPAKLPRPAPKRESLNSRASDFNPLEGPTVLSPPRKTRRVMPEREGFAGNAYQVDKNDE
HGDVKQAAGNYTGRSEQAPMSIDFSVFGSRPMSRPTINSADRSHLKRKLDLEFQHPE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaatgatggagaaaagaaagtggctgataggtatctaaagcgcgaaatactg
ggtgaaggtacttatggagttgtctacaaagccattgatactaagactggacaaacagtt
gcaattaaaaaaattcggcttgggaagcaaaaggaaggggttaattttactgcacttaga
gagattaaactgcttaaagagattaaagacccaaatatcatcgagttgattgatgcattc
ccccacaaggggaacttgcatctcgtgtttgagttcatggagactgatcttgaagcggtc
attcgtgatcgaaacattttcctttcaccagctgacataaagtcttactttcaaatgaca
ttgaaaggattggctgtttgccacaagaaatgggttctccatagggacatgaagccaaac
aatttgttgatagctcctaatggacagctcaaacttgcagattttggtttagctcgtata
ttcggaagcccagatcgcaagttcactcaccaagtctttgctcgatggtacagagcacct
gagctgttgtttggcaccaagcaatatggtgctggggttgatgtttgggcagcagcctgt
atttttgctgaactgctcctccgccgaccatttctgcagggaagtagtgacattgatcaa
ttaggaaagatttttcaagcttttggcactccatcaccttctcagtggcccgatttagta
tacctccctgattatgtggaataccaatctgttcctgctcagccttggcgtaaattattc
ccaatggctagtgatgatgctttagatctgttaataaagatgtttacttatgatccaaaa
gctagaattacagcagaacaggcattagagcacaggtatttctcatctgcacctctgcct
acagagccggcaaaactccctagacctgccccgaagcgggaatctcttaattctagggct
tcagattttaatccactcgagggacctactgtgttgtctcctccaaggaagacaagaaga
gtgatgcctgaacgtgagggatttgcgggaaatgcatatcaagttgataagaatgatgaa
catggtgatgtcaaacaggcagctgggaattacacaggcaggagtgagcaggctccaatg
tcaatagatttttctgtctttggatcaaggcctatgagcagaccaacaattaacagtgct
gacagatcccatttaaagaggaaactagatcttgaattccagcacccagaatag

DBGET integrated database retrieval system