KEGG   Ricinus communis (castor bean): 8278055Help
Entry
8278055           CDS       T01087                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00480  Glutathione metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    8278055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcu02000]
    8278055
Enzymes [BR:rcu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     8278055
Transporters [BR:rcu02000]
 Other transporters
  Pores ion channels [TC:1]
   8278055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_5 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 8278055
NCBI-ProteinID: XP_002532823
UniProt: B9T3K4
Position
Unknown
AA seq 219 aa AA seqDB search
MADEVILLDFWASPFGMRVRIALAEKGVKYEYREENLRNKSPLLLEMNPVHKKIPVLIHN
GKPICESLIAVQYIDEVWHDESPLLPSDSYPRAHARFWADFVDKKIYELGRKIWTTKGED
QEAGKKEFIDAIKLLEGELGDKPYFGGESFGYVDVALIPFYSWFYAYETCGNFSIEAECP
KFMAWIKRCLQKESVSKALPDQQKVYEFVLELKKVFGIE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaggtgatacttttggatttctgggcaagtccttttgggatgagagttaga
atagcactagcagagaaaggagtaaagtatgagtatagagaagagaatttaaggaacaaa
agccctcttcttttggagatgaatccagttcataaaaagattcctgttctcatccataat
ggaaaacccatttgtgaatcacttattgctgttcaatatattgatgaggtttggcatgat
gagtctcctcttttgccttctgattcttacccaagagcacatgctagattctgggctgat
tttgttgacaagaagatttatgaacttgggaggaagatatggactacaaaaggagaggat
caggaggcgggcaagaaagaattcatcgacgccattaagttgttggaaggtgagcttgga
gacaagccgtactttggtggtgagagctttgggtatgttgatgttgcacttatcccattc
tattcctggttttatgcctatgaaacctgtgggaacttcagcatagaggctgagtgtccc
aagttcatggcatggattaagaggtgcctgcagaaagagtctgtctccaaggcccttcct
gaccagcagaaggtctatgaatttgttttggagctgaagaaggtatttggtattgagtaa

DBGET integrated database retrieval system