KEGG   Ricinus communis (castor bean): 8279033Help
Entry
8279033           CDS       T01087                                 

Definition
(RefSeq) pollen receptor-like kinase 3
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcu01001]
    8279033
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8279033
Protein kinases [BR:rcu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   8279033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 8279033
NCBI-ProteinID: XP_002532730
UniProt: B9T3B1
Position
Unknown
AA seq 702 aa AA seqDB search
MALDWLLRPILLVFINIFILPSISSTSESEALIKLKSSFTDASALSSWVNGSTPCAGDTQ
WNGLLCSNGTVVGLRLEKMGLSGKIDVDALIDISGLRTVSFARNSFSGSIPELSRLGYLK
SIFLTGNQFSGEIPSDFFLKMVSLKKVWLSDNKFSGEIPSSLIHLSNLLELRLENNEFSG
NIPSIEQSTLTTFNVSNNKLRGQIPAGLEKFNSTSFEGNSELCGEMIGKECRTVSLAAAA
LISSVSKNAIYDKDSKSLKMTNAGIITLAAMLLSVVGVVIFKLSRKDKDFQVGGKDGSDA
DESVEVQVTMPVRSKEMEATKKLGSTRKGSNQNKGGGVAELVMVNNEKGVFGLPDLMKAA
AEVLGNGGLGSSYKALMTDGEAMVVKRLREMNALGRDGFDAEVRHLGKLRHPNILGPLAF
HYRKDEKLLIYEYMPTGSLLYLLHGDRGPSRTELNWPTRLKVVVGIARGLGYLHAELSSF
DLPHGNLKSSNIFLNYDNEPMISEFGFNQLTKPSVGRQALLAYKAPEAAQFGVSPKCDVY
CLGLVILEILTGKVPSQYLNYGNGEIDLVQWVQNSITEGRESELFDPDIASSTDSVGEIR
ALLHIGARCAESNPAQRLDLREAIERIEEIKLGIGYSDNRTMQLLPSLRDGYADSPPPFN
PSTSTKEGYGETSKRGRGSCSFTDSSQFSFASPGSTFLSNDN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggccttggattggcttctccggccaattcttctcgtgttcatcaacattttcatactt
ccatctatttcttcaacatccgaatcggaagcattgattaaactcaaaagttcttttact
gatgcaagtgcacttagttcttgggttaatggatcaactccttgtgcaggagacactcaa
tggaacggacttctttgtagcaatggcactgtagtaggtcttcgtcttgagaaaatggga
ttatcaggaaaaattgatgttgatgcattgattgatatttccggactcagaactgtaagc
ttcgcacgtaattctttttcgggttcgattcctgaattaagtcgtttagggtatctgaag
agcattttcttgacaggaaaccagttttcaggtgagataccatcagatttcttcttgaaa
atggtttcattgaagaaagtttggctttcggataacaagttttctggtgaaattccatct
tcattaattcatttatccaatcttcttgaattgcgtttggaaaacaatgaatttagtggt
aacattccatctatagagcaatcaacattgacaacattcaatgtgtcaaacaataagtta
agagggcaaatcccagctggtttagagaaattcaactcgacttctttcgagggaaattct
gaactttgtggggaaatgattggtaaagaatgtagaactgtatccttagctgcagcagca
ctaatcagttctgtatcaaaaaatgctatatatgacaaagatagtaaatcactaaagatg
acaaacgcagggatcataacattagccgcaatgctgctttctgtagtcggtgtggtaata
tttaaactgagccgaaaagataaggatttccaagtgggtggaaaggacggcagtgatgct
gatgagtcggttgaggtgcaagttacaatgccagttagatccaaggaaatggaagcaacc
aagaagctaggatcgacacgtaaaggaagtaatcaaaataagggtggtggtgtagcagaa
ttagtgatggtgaacaacgagaagggtgttttcgggttgccagatttgatgaaagctgct
gcagaagtgcttggaaatggtggattagggtcttcatataaggctttgatgaccgatggc
gaggcaatggtggttaaaagactcagagaaatgaatgcactaggaagagatggatttgat
gcagaggtcaggcatcttggaaaactaaggcatcctaatattttgggaccattggcattt
cattatcggaaagatgagaagttgttgatatatgaatacatgcctacgggcagcttactt
tatttattgcatggtgataggggaccttcacgtactgaactcaattggcctactcgtctc
aaggttgttgtaggaattgctagaggattaggctatctacatgctgaactttcttccttt
gacttgccccatggcaatctcaaatcaagcaatatctttcttaattatgacaatgaacca
atgatttcagaatttgggttcaatcaactgaccaaaccttctgttggaagacaagctcta
cttgcctataaggcccctgaagctgcccaatttggagtttcccccaaatgtgatgtatac
tgtctaggacttgtcattcttgaaatcctgacaggaaaagttccttctcaatatcttaac
tatggcaatggagaaattgatctagtccaatgggtgcaaaattcaattaccgagggaaga
gaatccgaattgtttgatcctgacattgcaagctccacagattcggttggagagataaga
gcactcttacacataggcgctcgttgtgctgaaagcaatcctgcgcagcggttagacctg
agagaagctattgagaggatagaggaaataaaactgggaatcggttattcagataataga
acaatgcaattgttaccatcccttcgagatggctatgcagattctcctcctccattcaat
ccatctactagtactaaagaaggttatggtgagacctctaaaaggggacgcggatcatgc
agctttacagatagttcacaattttctttcgcatctcctggctcgacctttttaagcaat
gacaactag

DBGET integrated database retrieval system