KEGG   Ricinus communis (castor bean): 8279668Help
Entry
8279668           CDS       T01087                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00250  Alanine, aspartate and glutamate metabolism
rcu00650  Butanoate metabolism
rcu01100  Metabolic pathways
Module
rcu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    8279668
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8279668
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     8279668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 8279668
NCBI-ProteinID: XP_002529810
Position
Unknown
AA seq 604 aa AA seqDB search
MHKLQASQSALHEKHGVVIVSTKESVRIRLATLKEKHPSLLITHSRYSSLLGLLANVDNS
KHSGKENMAMAGRLRLVPSLRNRMLRSMSASIAGPAVQRSVLCRAFTSEVCMKTESLAAR
LRNAGLLRTQGLIGGKWTDAYDGKTIQVHNPATGEVIADVPCMGGNETKDAISSAHDAFQ
SWSKLTASERSKHLRRWFDLLIAHKEELGQLITLEQGKPLKEAIGEVSYGASFIEFFAEE
AKRVYGDIIPATLGDRRLLVLKQPVGVVGAITPWNFPLAMITRKVGPALACGCTVVVKPS
ELTPLTALAAAELALQAGIPPGVLNLVMGKAPDIGDALLASPQVRKITFTGSTAVGKKLM
EGAARTVKRVSLELGGNAPCIVFDDADLDVAVKGSLAAKFRNSGQTCVCANRLIVQEGIY
DKFAETFSRAVQNLQVGDGFTEGVAQGPLINEAALQKVESFVQDAISKGAKVLIGGKRHS
LGRTFYEPTVISDVKSEMVVSREEVFGPVAPILRFKTEEEAISIANDTNAGLAAYIFTNN
TQRSWRVAEALEYGLVGVNEGLISTEVAPFGGVKQSGLGREGSKYGMDEYLELKYVCLGD
MNRK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagttacaggcgtcacaatctgcattacacgaaaagcacggagtggtcatcgta
tcaactaaagaatccgtcagaataagactcgcaactcttaaggaaaagcatccatcactc
ctcatcactcactctcgctacagcagccttctcggactgctagcaaacgttgacaacagc
aagcactctggaaaagaaaatatggcaatggctgggcgtctgagattggttccctctctc
cgaaatcggatgctgagatcgatgtctgcctctattgccggacccgccgttcaacgctcc
gttctctgccgtgctttcacatctgaggtatgcatgaaaactgagagtcttgctgctcgg
ctacgtaatgcagggctattacgaactcagggtcttattggtggaaagtggactgatgca
tatgatgggaagacaattcaggttcataatccagcgactggtgaagttatagcagatgtc
ccatgcatgggtggaaatgagacaaaggatgcgatatcatctgctcacgatgcatttcaa
tcctggagcaaactcactgccagtgagaggagcaaacatttacgaagatggtttgactta
ctaattgcccacaaagaggaacttggacaactaataaccttggaacaagggaagcctctc
aaagaagccataggtgaggttagctatggagccagtttcattgagttctttgcggaggag
gcaaaacgtgtatatggtgacataatcccagctactcttggtgatcgtcggttacttgtt
ctgaagcagcctgtaggtgttgttggagcaattacgccctggaattttcccttggccatg
atcactcgtaaggttggtccggccctcgcttgtggttgtacagtggttgtaaagccctct
gaacttacacctctcacagccttagcagcagcagagctagcccttcaagctggaataccg
ccgggtgttctgaatttggtcatgggaaaggctcctgatattggagatgctttacttgca
agtccacaggttagaaagatcacatttacaggctcaactgctgtgggaaagaagttgatg
gaaggtgctgctaggactgttaaaagggtgtctctggaacttggtgggaatgcaccctgc
attgtatttgatgatgcagaccttgatgtggcagtaaaaggatcacttgcagcaaagttc
cgtaatagtggacaaacatgtgtctgtgcaaatcgattaatcgtacaagaaggtatctat
gacaaatttgctgagactttttcaagagctgttcagaatttgcaagttggggatggattt
actgaaggtgtggcccagggtccattaattaatgaagctgctctgcagaaggttgaatca
tttgttcaagatgccatctcaaagggtgcaaaagttcttatcggaggcaaaagacatagt
ttggggaggactttctatgagcctactgtaattagcgatgtcaagagtgagatggttgta
tccagagaggaagtatttggaccagtggcaccgatattgcggttcaagactgaggaggaa
gctatctctattgctaatgacaccaatgcaggattagcagcatatattttcacgaacaat
acacaacgttcatggcgtgtcgctgaagctctggagtatggactcgtaggcgtcaatgaa
ggacttatttcaacagaggtggctccatttggaggagtaaaacagtctggtctaggaagg
gaaggctccaagtatgggatggatgaatatttggagctcaaatatgtatgcttaggagat
atgaacagaaaatga

DBGET integrated database retrieval system