KEGG   Ricinus communis (castor bean): 8279861Help
Entry
8279861           CDS       T01087                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00052  Galactose metabolism
rcu00500  Starch and sucrose metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8279861
   00500 Starch and sucrose metabolism
    8279861
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8279861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 8279861
NCBI-ProteinID: XP_002532576
UniProt: B9T2V7
Position
Un
AA seq 649 aa AA seqDB search
MADPNPFLPISQPLDPLPDGGSPPTAHRRQSKKMLFVVFSGLFLVFLFAAIIDNNKGFKN
NIHDDNVIPLTMSQETVKPEILRPVSRGVSAGISEKVNLISSSPQTPEYPWNNSMLSWQR
SAFHFQPEKNWMNDPNGPLFYNGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPLA
MVADEWYDQNGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPEDHDDPLLLKWVKYS
GNPVLVPPPGIKSLDFRDPTTAWFTSEGKWRITIGSKVGRTGIALIYDTEDFINYELQQH
ELHGVSGTGMWECVDFYPVSKSSANGLDTSANGPQVKHVLKTSLDDDRHDYYALGNYNEK
NGTWYPDNPEIDTGIGIRYDYGIFYASKTFYDQNKGRRLLWGWIGESDSEAADVKKGWAS
LQSIPRTVLLDTKTGSNLLQWPVEEVESLRLRSNEFEKLEVKPGSVVPLHIDAATQLDIV
AEFELDKKVLANAAESNEEFSCKTSRGAAHRNALGPFGLLVLADESLAEQTPVYFYVAKG
KNGTLKTFFCTDQKRSSAANDVNKQIYGNFVPVLEGEKFSVRILVDHSIIESFAQGGRTC
ITSRVYPTRAIYGAAKLFLFNNALEANVTASLKIWQMNSAFIRPYPNIR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctaatccattcctcccaatttctcaaccactagaccctctccctgatggc
ggatctccgcccaccgcccaccgccgtcagtccaagaaaatgctcttcgtggtcttttcc
gggttgttcttggttttcttgtttgcagctataattgacaataacaaaggatttaagaat
aatatccatgatgataatgtaattccattaactatgtctcaagaaactgtaaaaccggag
atactgagacccgtgtcacgtggtgtgtcggccggtatatcggagaaagtgaacttgatt
tctagcagtccgcaaacgccagagtatccatggaataatagtatgttatcatggcaaaga
agtgctttccatttccaacccgaaaagaactggatgaacgatcctaatggcccattattt
tacaacggctggtatcatttcttctatcagtacaatccaaatgctgcggtgtggggggac
atagtctggggccatgctgtatcgaaggacttaatccactggcttcaccttccattagca
atggttgctgatgaatggtatgaccaaaatggtgtctggacggggtctgctactatcctt
ccagacggtaaaattgttatgttatacactgggtctaccaatgagtcagttcaagtgcag
aatcttgcatatcctgaagaccacgatgatcctctcctcctaaaatgggtcaagtactct
ggcaacccagttctagtcccgccaccaggcatcaaaagcttggactttcgtgatcccaca
actgcttggttcacttctgaagggaaatggaggattactataggatctaaagttggtagg
actggcatagctcttatatatgacactgaagatttcataaattatgaattgcaacagcat
gaacttcacggcgtcagtggcactggcatgtgggagtgtgtggacttttatcctgtatcg
aaaagtagtgccaatggattggacacatctgctaatggtcctcaagtgaagcatgtactt
aagacaagtcttgatgatgacagacatgattattatgcacttggaaattacaatgaaaag
aacggtacatggtatcctgataatcccgagattgatactggtattgggattaggtatgac
tatggtatattctatgcgtccaagacattctatgatcagaacaaggggagacgactgttg
tggggttggattggtgagtccgatagtgaagctgctgatgtcaagaaaggatgggcatct
cttcagagcattccaaggacggttttgttggacacaaagactggcagcaatctgcttcag
tggccagtggaagaggtagagagtttgagattaagaagcaatgaattcgagaagcttgag
gtcaagccaggttcagttgtgcccctccatattgatgcagccacacagctagatatagtt
gcggagttcgagctagacaagaaggttttggcgaatgcagctgaatcaaacgaagaattt
agctgcaagacgagtcgtggagctgctcaccgcaatgcattaggaccattcggtcttctg
gttcttgcagatgaaagcctagctgaacagactcctgtgtacttctatgttgcaaaagga
aaaaatggcactctaaaaactttcttctgcacagaccagaaaaggtcctctgcagcaaat
gatgttaacaaacaaatttatggaaactttgtcccagtcctagagggtgaaaagttctct
gtgagaatattggtggatcattcgataatcgaaagctttgctcagggtggtcggacatgc
ataacctccagggtttatccaacaagagcaatctacggagccgccaagctgttcttgttc
aacaatgctcttgaggccaatgttacagcttcactaaagatatggcaaatgaattctgca
ttcattcgcccctatcccaatattcggtag

DBGET integrated database retrieval system