KEGG   Ricinus communis (castor bean): 8280754
Entry
8280754           CDS       T01087                                 

Definition
(RefSeq) alpha-copaene synthase
  KO
K22065  alpha-copaene/(+)-delta-cadinene synthase [EC:4.2.3.133 4.2.3.13]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00909  Sesquiterpenoid and triterpenoid biosynthesis
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    8280754
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.13  (+)-delta-cadinene synthase
     8280754
    4.2.3.133  alpha-copaene synthase
     8280754
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth Hormone_recep HEF_HK
Other DBs
NCBI-GeneID: 8280754
NCBI-ProteinID: NP_001310685
UniProt: B9S9Z3
AA seq 558 aa
MSLQVSAVPIKTSTQNATSAVKRHSSTYHPTIWGDHFLANLSHSKIIDGSIEQQFEGLKQ
KVRKMIIDLNNEPCKKLGLIDAVQRLGVGYHFKSEIEDVLQKVYHDYSDDEDDLNTVALR
FRLLRQHGIKVSCAIFEKFKDSEGNFKTSLINDALGMLSLYEATHLSIRGEDVLDEALAF
TTTNLQSVLPQLNTHLAAQISRALNRPIRKYLPRLEARNYIDIYATEESYNTTLLNFAKL
DFNMLQELHQKELNVVTKWWKSLDVATKLPYARDRVVECYFWMVGVYFEPQYSFARIMMT
KIIAITSLLDDTYDNYATGEELEILTEAIERWDIKAKDALPEYMKIIYTTLLDIYNEYEE
NIAKEEKSLLYSVYYAKEVMKRVVRAYLAEVRWRDNCYTPTMEEYMQSALLTTCSPMLAI
ASFLGLKEIATKEAYEWASEDPKIIRASSIVCRLMDDIVSHEFEQTRKHVASGVECYIKQ
YGASEEEVIKLFRKEVTNAWKDLNEECLNPTPVPMPMLERVVNLTRAIDVIYKDDDGYTN
SHIMKDYVASVLKDPVPV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtctctgcaagtttcagcagtccctattaagacttcaacccaaaatgcaacatctgct
gttaaacgacactcttctacttatcatccaacaatctggggagatcattttcttgcaaat
ctttctcactctaagataattgatggttcaattgaacaacaatttgaaggactaaagcaa
aaagtgagaaagatgataatcgacctcaacaatgagccttgcaaaaaattgggtttgatt
gatgcagtccaacgcttaggtgttggttaccatttcaagagtgagatagaagatgtgttg
caaaaggtgtatcatgattatagtgacgatgaggatgaccttaacactgttgctcttcga
tttcgattactcagacagcacggaattaaggtttcatgtgcgatatttgagaaattcaaa
gacagtgaaggaaacttcaagacatccttaattaatgatgcgttgggtatgctgagttta
tatgaggcaacacatcttagcatacgaggtgaggatgtcttagatgaagccttagctttt
actacaacgaaccttcaatcagtattgcctcaattgaacactcatctagcggcacaaata
agtcgtgccctcaatcgtcccatcaggaaatatctaccaaggttagaggcaaggaactat
attgatatctatgcaaccgaggaatcatataataccacattactaaatttcgcaaagttg
gatttcaacatgttacaggaactgcatcaaaaagagctaaatgttgtcacaaagtggtgg
aaaagtttagatgtggcaacaaaactaccttatgctagagacagagtggtggagtgctac
ttttggatggttggagtttactttgaacctcaatattcttttgcaagaataatgatgaca
aaaataatagccattacatcattgttagatgatacttatgataattatgctacgggtgaa
gaactcgagatcttaacagaagctatagaaaggtgggacattaaggccaaagatgcactt
ccagagtacatgaaaataatttacactacattattagatatctataacgaatatgaagag
aatattgcaaaagaagaaaagtcattattatattctgtgtattatgcaaaagaagttatg
aagagagtagtgcgagcctatttggctgaagtcaggtggcgtgataactgctacactcct
acaatggaagaatatatgcaatctgcacttttaactacttgttccccgatgttggcaata
gcttccttccttggcctgaaggaaatagcaacaaaagaagcatacgagtgggcttcagaa
gaccctaagattattagagcttcatcaatcgtgtgcagacttatggacgacattgtatcc
catgagtttgagcaaacgaggaaacatgttgcttctggtgttgagtgctacattaagcaa
tatggtgcttcagaggaagaggtaattaaattgttccggaaagaggttacaaatgcgtgg
aaagatttgaatgaggagtgcctcaacccaactccagttcctatgccgatgctagagcgt
gttgtgaatcttacacgggcaattgatgtcatatacaaagatgatgatggatacacaaat
tctcacatcatgaaagactatgttgcttcggtactcaaagaccctgtaccagtttga

DBGET integrated database retrieval system