KEGG   Ricinus communis (castor bean): 8281654Help
Entry
8281654           CDS       T01087                                 

Definition
(RefSeq) melanoma-associated antigen 1
  KO
K22823  non-structural maintenance of chromosomes element 3
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rcu03400]
    8281654
DNA repair and recombination proteins [BR:rcu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     8281654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE
Motif
Other DBs
NCBI-GeneID: 8281654
NCBI-ProteinID: XP_002513929
UniProt: B9RJL0
Position
Unknown
AA seq 230 aa AA seqDB search
MASSSQDFSQLNISGEEKDKLVAEVIRYVLFKTHQNSGCPIKRDELTQIVTKNYRQRLLP
AFVINEAIAKLSTIFGFELRELQRSRPSSTNHQSTNDAKSYVLISQLPADVYRKYVEDVN
TAHLTGFTFVVISIVHLAGGKVPEENLWHHLRRMGLHETDESHPVLGNIKQALEMLVQQR
YLQKDKVNGPDGSTTVYELAERALDGPVNERIKEYISQIVKKDFATVDID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttcaagtcaagatttctctcaattgaacatttcgggagaggaaaaagacaag
cttgtagcggaagtgatacgatacgtgctttttaaaacgcaccaaaattccggttgcccg
atcaaaagagacgagcttactcaaatcgttactaaaaactatcgtcagcggttgcttcct
gcttttgttattaatgaggccatagctaagctctctaccatttttggcttcgaactgagg
gagcttcaaagatctcgtccttcctccactaatcaccaaagtactaatgatgctaaatcc
tatgttctcatcagtcaactacctgctgatgtgtacaggaaatatgttgaggatgtaaat
acagcacatctgactggttttacatttgtcgtaatcagtattgtgcaccttgctggaggc
aaagtcccagaggaaaatctttggcatcacttgaggcgcatggggttacatgaaactgat
gaaagccatcctgtccttggaaacatcaagcaggcattggaaatgctcgtccagcaaaga
tatttgcagaaagacaaagttaatggtcctgatggtagtactacggtttatgagcttgct
gagagagctttagatggcccagttaatgagagaattaaagaatacatatcacagattgtc
aaaaaggacttcgcaactgtggatattgactaa

DBGET integrated database retrieval system