KEGG   Ricinus communis (castor bean): 8283141Help
Entry
8283141           CDS       T01087                                 

Definition
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00010  Glycolysis / Gluconeogenesis
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8283141
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     8283141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh Cys_rich_CWC
Motif
Other DBs
NCBI-GeneID: 8283141
NCBI-ProteinID: XP_002530500
UniProt: B9SWY1
Position
Unknown
AA seq 607 aa AA seqDB search
MDTNIGSIDTLKPTTTDVCCPANGAVCTLQSSTVSPSSIVSSPDSTLGRHLARRLVQVGV
TDVFSVPGDFNLTLLDHLIAEPGLNVIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL
SVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQPVTCFQAIV
NNLEDAHELIDTAISTALKESKPVYLSISCNLSAIPHPTFSREPVPFSLSPRLSNKIGLE
AAVEAAAEFLNKAVKPVLVGGPKLRVAKACEAFVELADACGYALAVMPSAKGLVPEHHSH
FIGTYWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKSIIVQPDRVVIGN
GPAFGCVLMKDFLKALAKRLKNNTTAHENYRRIFVPEGQPLKSQPKEPLRVNVLFQHIQK
MLSSETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIA
CIGDGSFQVTAQDVSTMLRCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAI
HNGEGKCWTAKVQCEEELIEAIETATESKKDCLCFIEVIAHKDDTSKELLEWGSRVSAAN
SRPPNPQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaacattggatctattgacaccttgaaacccacaacaactgacgtgtgctgt
ccagcaaacggcgccgtttgcaccctccaaagctccacagtctccccatcatcgatcgtc
agctcgcctgactccactctcggccgtcacttggctcgccgtcttgtgcaagtcggtgtc
actgatgtcttctctgttcccggtgactttaacctcactcttcttgatcatttgattgct
gagcctggacttaacgttattggctgttgtaatgagctcaatgctggatatgctgctgat
ggttacgcaagatcacgtggtgttggtgcttgtgttgttactttcactgttggtggatta
agtgttctcaatgctattgctggtgcttacagtgaaaacttacccgttgtatgtattgtt
ggtggacctaactccaacgattatgggactaacaggatcttgcatcataccattggtctg
cctgattttagtcaggagttgaggtgtttccagcctgttacatgctttcaggctattgtg
aataatttggaagatgcacatgagctgattgatactgctatatcaactgctttgaaagaa
agcaagcctgtttatctcagcattagctgtaacttgtcagcgatccctcatcctactttt
agtcgcgagccagttccattttcactctctcccagattgagtaataaaattggtttggag
gctgctgttgaagcagcagcggagtttttgaacaaagcagtgaaaccagttttggttggt
gggcctaaactgagggttgcaaaggcatgtgaggcctttgttgagttagctgatgcttgt
ggttatgcccttgctgtgatgccatcggctaaagggcttgtgccggaacaccattctcac
ttcattggtacttattggggtgcagtcagcactgccttctgtgctgagattgtggaatct
gcagatgcttacttgttcgctggacccattttcaatgactacagctccgttggatactct
ctccttctcaagaaagagaagtcaatcatcgtgcagcctgatcgtgtggtgattggaaat
ggacctgcatttggatgtgttttgatgaaggattttcttaaagccctagcaaagaggctc
aagaacaatactactgctcatgagaactaccgtagaatttttgtccctgaagggcaacct
ttgaaaagtcaacctaaagaaccattgagggttaatgttctgttccaacatatacagaaa
atgctgtctagtgaaactgctgtgattgcagagacaggggactcatggttcaactgtcag
aagctgaaattaccaaagggatgcgggtacgaatttcaaatgcagtatggatcaattggt
tggtcagttggggcaactcttgggtatgctcaggcggtgcctgagaaacgtgtgattgct
tgtattggagatggtagctttcaggtgactgctcaagatgtgtcaacaatgctgcgatgt
ggacaaaagaccatcatcttcttgatcaataatggtgggtataccattgaggttgagatc
cacgatggtccttacaatgtgataaagaactggaactacactggcttggttgatgcaatt
cacaatggtgaaggcaagtgctggacggccaaggtccaatgcgaggaagagctgattgaa
gcgattgagactgcgacagagtcgaagaaagattgcttatgcttcattgaggttattgct
cacaaggatgatacaagcaaagaactgttggaatggggctcaagggtctctgccgccaat
agccgcccaccaaaccctcagtag

DBGET integrated database retrieval system