KEGG   Ricinus communis (castor bean): 8285804Help
Entry
8285804           CDS       T01087                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00670  One carbon pool by folate
rcu01100  Metabolic pathways
rcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    8285804
Enzymes [BR:rcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     8285804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-GeneID: 8285804
NCBI-ProteinID: XP_025015306
Position
Unknown
AA seq 354 aa AA seqDB search
MRERLGKMVIGNSKAGDPITADDLGLEGALTVLIKDAINPTLMQTLEGTPVLVHAGPFAN
IAHGNSSIVADKIALKLVGPGGFVVTEAGFGADIGTEKFMNIKCRYSGLVPQCAIIVATI
RALKMHGGGPEVVAGKPLDRAYTTENVALVEAGCVNLARHISNTKAYGVNVVVAVNMFST
DSEAELNAVKNAALAAGAFDAVVCTHHAHGGKGAVDLGIAVQRACENVTQPLKFLYPLDI
SIEEKIEAIARSYGASAVEYSEQAKKQIEMYSRQGFSGLPICMAKTQYSFSHNAAEKGAP
SGFILPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDVDTATGKVIGLS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagagagaggcttggaaaaatggtgattggaaatagcaaggctggtgatccaataaca
gctgatgatcttggtcttgaaggtgctttgactgtactaattaaggatgcaattaatcct
actttaatgcagaccctggaaggaacccctgttcttgttcatgctggtccttttgcaaac
attgctcatggaaattcttctattgttgctgataagattgcattgaaactggtcggacct
ggtggctttgtggtcacagaagcaggctttggtgctgacattggaaccgaaaagtttatg
aatataaagtgccgatatagtggtttagtgcctcagtgtgctattatcgttgcaacaatt
agggccctgaaaatgcatggtggtgggccagaagtagttgctgggaagcctcttgaccgt
gcctatacaactgagaatgtggctttggttgaagctggttgtgtaaatctggctaggcat
atttcaaacaccaaagcttacggtgtaaatgttgttgttgctgtgaacatgttctcaact
gattctgaagcagaacttaatgcagttaaaaatgcagcattggcagctggggcatttgat
gctgttgtctgcacacatcatgcccatggtgggaagggagcggtggatctaggaattgca
gttcaaagggcctgtgagaacgtgacacagccgttgaagttcttatatcctttggacatt
agcattgaagagaaaatcgaggcaatagcaaggtcatatggtgctagtgctgttgagtac
tcagagcaggctaagaagcagattgagatgtacagccgacaggggttctctggtctacca
atctgcatggctaagacccagtattcattttcacacaatgcagctgagaaaggagctcct
tctggatttattttaccgattagggatgtgagggcaagcatcggggctggttttatttat
cctttagttgggacaatgagcaccatgccggggcttccgacaaggccttgcttttatgac
attgatgtcgacactgccactggtaaggtcattggtctgtcgtga

DBGET integrated database retrieval system