KEGG   Ricinus communis (castor bean): 8286467Help
Entry
8286467           CDS       T01087                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8286467
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     8286467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 8286467
NCBI-ProteinID: XP_002525658
Position
Unknown
AA seq 498 aa AA seqDB search
MSWFTNLIRISTVKSASSSTKSLPPLITNPNFLISSLFHFSTHAHPPPQYAGLPPTKPGE
KPRLVVLGSGWAGCRLMKGIDTKLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIA
RIQPAISKEPGSYFFLANSTAIDTHSHLVHCETATDGSSTMDPWKFDISYDKLVIALGAE
ASTFGIHGVKEHAIFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPT
GVEFSGELSDFITRDVRQRYAHVKDYIHVTLIEANEILSSFDDRLRHYATKQLTKSGVQL
VRGIVKDVKPQKLVLSDGSEVPYGLLVWSTGVGPSHLVKSLDLPKSPGGRIGIDEWLRVP
SVPDVFAIGDCSGFLESTGKSVLPALAQVAERQGKYLAGLLNKIARAGGGQANSCVDIEL
GDPFVYRHLGSMATIGRYKALVDLRQSKEAKGISLAGFVSWFVWRSAYLTRVISWRNRFY
VAINWATTLVFGRDISKI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttactaacctaatccgaatctccactgtcaaatcagcgtcttcttccacc
aaatcactgccacctctaattacaaatcccaattttctcatctcctccctcttccatttc
tccacccacgcccaccctccgccgcagtatgcagggcttccgcccaccaagcccggcgag
aagcctaggctcgtcgttttggggtctggatgggctggctgccgtctgatgaagggcata
gacaccaagttgtacgatgtggtttgcgtttcgcccaggaatcacatggtattcactcct
ttactggcttctacttgcgtcggaacccttgagttcaggtctgtagccgagcccatcgcc
cgcatccagcctgccatctccaaggagcccggttcctatttctttctcgccaattccact
gctattgatactcatagccatttggtgcattgcgagactgctactgatggatcaagtacc
atggatccatggaaatttgatatctcctatgataagttggtaatagcattgggagcagaa
gcttccacatttggaatacatggtgtcaaagagcatgccatctttcttcgggaagttcac
catgctcaagaaattcggcgaaagctgcttctaaacttgatgctttctgatgtccctggt
atttcagaagaagagaagagcagattgttacactgtgttgttgtaggaggtggtcccact
ggagttgaattcagtggtgaacttagtgattttatcacgagagatgttcgtcaaagatat
gcccatgttaaggattatattcatgttacattgatcgaggcaaatgagatattatcttcc
tttgatgatcgccttcgtcactatgctactaaacagttgacaaagtcaggagttcaactt
gtccgtgggattgtcaaagatgttaaacctcagaagctagttcttagtgatggctcagag
gttccatatggtctcttggtctggtcaacaggcgttggcccctcacatcttgtaaaatca
ctggacctcccaaaatctccaggtggaaggattggtattgatgagtggcttagagtccct
tctgtgccagatgtgtttgctattggtgactgcagtggatttcttgaaagtactggtaaa
tcagttcttccagctttagctcaggttgcagagcggcaaggaaaatatcttgctggtctc
ttgaacaaaattgctagagctggtggagggcaggcaaacagttgtgtagacatagaattg
ggagatccatttgtttacagacatctgggaagcatggcaactatcggcagatacaaagcc
cttgttgatcttaggcagagtaaagaggccaaagggatttctttggcaggatttgtcagt
tggtttgtctggcgctctgcatatctaactcgtgtaataagctggaggaacagattctat
gttgctattaactgggccacaactcttgtgtttggtcgtgatataagcaaaatatag

DBGET integrated database retrieval system