KEGG   Ricinus communis (castor bean): 8288379
Entry
8288379           CDS       T01087                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00100  Steroid biosynthesis
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Module
rcu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    8288379
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     8288379
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 8288379
NCBI-ProteinID: XP_015580486
Position
Unknown
AA seq 368 aa
MDLGFVLHSLIPSWNSVIVLVIFFVYLAIFGSILPGKLVPGVILQDGSRLYYRCNGLLSL
LLLVALLGIGTKLDLISPTVISERGLELLSATFIFSVLVTLVLYAAGCNSRNQGSSLKPH
VTGNLIHDXXXXXXXXQQYISLCRFFFVRAGMMGWLIINLSVLAKSIQDATLSCSMVLYQ
LFCALYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLGNKVELTT
VAVIANCIVFLIGYLVFRGANKQKHVFKKNPKALIWGKPPMVIGGKLLASGYWGIARHCN
YLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAEYRALVP
WRILPYFY
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggatctgggttttgttctacactctctaattccttcatggaactctgtcattgtacta
gttatattctttgtttatctggccatctttggatctatattgcctggcaaacttgttcct
ggagtgatcttgcaggatggttctcgactctattatcgttgcaatgggttgttgtcattg
ctgttgctggttgctcttcttgggattggtactaaattggatcttatatcacccactgtg
atctcagagagggggcttgagctgctatcagcaacttttattttcagtgttcttgtgact
ttggtactctatgctgctggttgcaattcaagaaaccagggatcttctcttaagcctcat
gtcactggaaacctaatacatgactgnnnnnnnnnnnnnnnnnnnnaacaacaatatatt
tctctttgtagattcttctttgttagagctggaatgatgggatggctaattatcaaccta
tcagttctagcaaaaagtattcaagatgcgaccttgagctgttcaatggttctttaccaa
ttattctgcgcgttatacatcctggattactttttctatgaggagtatatgacctctaca
tgggacattattgccgagagattgggcttcatgttggtatttggtgatctggtctggatt
cctttcacttttagcatccagggttggtggcttttgggtaacaaggtggagctaacaaca
gttgctgtcattgcaaattgcattgtttttctgattgggtatctggtctttagaggagct
aacaagcaaaagcatgttttcaaaaagaatcccaaagctctcatatggggtaagccacca
atggtaataggaggaaagcttcttgcttctggttactggggcattgcaagacattgtaat
tatcttggagacctgttgttggctctgtcctttagtctaccttgtgggataagttccccg
gttccatacttctacccaatttaccttcttattctgctaatatggagagaaagaagagac
gaagctcgctgtgcagagaagtataaagaaatatgggctgaatacagggcacttgttccc
tggagaatattaccatacttttattaa

DBGET integrated database retrieval system