KEGG   Ricinus communis (castor bean): 8288826Help
Entry
8288826           CDS       T01087                                 

Definition
(RefSeq) N6-adenosine-methyltransferase MT-A70-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rcu03019]
    8288826
Enzymes [BR:rcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     8288826
Messenger RNA biogenesis [BR:rcu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     8288826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Macro
Motif
Other DBs
NCBI-GeneID: 8288826
NCBI-ProteinID: XP_002518893
UniProt: B9RYS4
Position
Unknown
AA seq 741 aa AA seqDB search
METQSDGTFNSSDDTSSVSTIKTLRSRLESRIETQHNSQLDLIASLRSLVPNIVSSLDVS
LQIVSSFNYKPFTPTPPLPNPTKTAIEITNPPQNPSSPQIGIHSKPESSNIDTKKPKPNQ
LNGNNDKFDIDENGSPLSVVRVMVAECLLQRVPFDPIDSSTVLRKLENDQNATAAEKAAL
REVGGESGAILAVEMALRSMAEENHGIELEEFVVSGKSRVMILNIDRNILVKELPESAQY
QQQLESDLNQNHNQGNSNNGGVDVNNSGGFGMGGQVMQRPMPADMWMGGDMWNGPPRGGM
VGPRGMMMGTRGMMQRPPLPMQQQQKQRTEEDDLKDLEALLNKKSFMEMQKSKTGEELLD
LIHRPTAKETAVAAKFKTKGGSQLKEYCSALTKEDCRRQSGSFIACEKVHFRRIIAPHTD
VSQGDCSFLDTCRHMKTCKYVHYELDPTPDVPPMMMGAPPKALKPQRAEYCSEVELGEPQ
WINCDIRNFKMEILGQFGVIMADPPWDIHMELPYGTMADDEMRNLNVPVLQTDGLIFLWV
TGRAMELGRECLDLWGYKRVEEIIWVKTNQLQRIIRTGRTGHWLNHSKEHCLVGIKGNPE
VNRNIDTDVIVAEVRETSRKPDEMYPLLERISPRTRKLELFARMHNTHAGWMSLGNQLEG
VRLVDDGLRARFKAAYPDVMVQPSSPPRASAMEVESASQMRNPFAVTEPKSTAAHSAEHA
ALETAYISEEKPMAVDTDMAG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagacccaatcagatggcaccttcaacagcagcgatgacacttcttcagtatccaca
atcaaaacccttcgttctagactagaatcccgaattgaaacccagcacaattcccaactc
gaccttatagcatcactccgatctttagtgcctaacattgtttcttctcttgatgtttct
cttcaaatcgtctcttcgttcaattacaaaccctttaccccaacgcctccactccccaac
ccaacaaaaacagccatcgaaatcacaaacccaccacagaacccgtcgagtcctcaaatc
ggtattcactcaaaacctgaaagttccaatattgacaccaagaaaccgaaaccgaaccaa
ttgaatggtaacaatgataagtttgatattgatgaaaatgggtctcctttgtctgttgtg
agggttatggttgcggagtgtttattgcagagagtaccttttgatcctattgattcttcg
acggttttgaggaagctggagaatgaccagaatgcgacggcggcggagaaggctgcgttg
agagaggtgggtggtgagtctggtgctattcttgcagttgagatggctttgaggtcaatg
gctgaagagaatcatgggattgagttggaggagtttgtggttagtggtaagtctagagtt
atgattttgaatatcgatagaaatatattagttaaggaattgcctgaaagtgctcagtat
caacagcagttagagtctgatttaaatcagaatcacaatcagggtaatagtaataatggc
ggggttgacgtgaataacagtggaggttttgggatgggaggacaggtaatgcagagacca
atgccggcagatatgtggatgggtggggatatgtggaatgggcctcctagaggagggatg
gtgggtccaagggggatgatgatgggaacgagagggatgatgcagagaccaccattgcca
atgcagcagcagcagaagcaaagaactgaggaagatgatttgaaagatttggaagctttg
cttaataagaagtcatttatggagatgcagaagtccaagactggagaggagcttttggac
ctcatccatcggcctactgccaaagaaactgctgtggctgctaagttcaagaccaaaggt
ggttctcaactgaaggagtactgttcagctctaacaaaagaggattgcaggcgtcaatcg
ggttcctttatagcatgtgagaaggtccattttcggcgaattattgctcctcatactgac
gtcagtcagggtgactgttcttttctagacacttgtcgtcacatgaagacatgcaagtat
gttcattatgagcttgaccctactcctgatgtaccacctatgatgatgggtgctcccccc
aaagctttaaagccccagcgtgcagagtattgctcagaagtagaactcggtgaaccacaa
tggattaattgtgatattcgtaattttaaaatggagattttagggcaatttggagttata
atggctgatccaccttgggatattcatatggaactgccttatggaacaatggctgatgat
gaaatgagaaaccttaatgttcctgtattacagactgatggtttgattttcctttgggtt
actggacgtgcaatggagcttggacgcgagtgtttggatctctggggttacaagcgtgtt
gaggagataatatgggtaaagactaatcaacttcagcgaattattagaacaggccggaca
ggccattggctcaatcatagcaaggagcattgtcttgttggaattaagggaaacccagaa
gtgaacaggaatattgatactgacgtcattgttgccgaggttcgagagacaagccgtaag
ccagatgagatgtaccctttgctggagaggattagtccaaggacgagaaagcttgaattg
tttgcacgcatgcacaatactcatgctgggtggatgtcacttggtaatcaattggaggga
gtgcgactggttgatgatggcctgcgagctagatttaaggctgcttacccagatgttatg
gtgcaaccttcctctcctccccgggcttctgctatggaagtagaatctgcttctcaaatg
aggaatccttttgcagtgacagaaccaaagtcaactgccgcacattcagcagagcatgca
gctctggagacggcctatatttctgaagagaagccaatggctgtagatactgatatggct
ggctga

DBGET integrated database retrieval system