KEGG   Ricinus communis (castor bean): 8289730Help
Entry
8289730           CDS       T01087                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
rcu  Ricinus communis (castor bean)
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rcu01009]
    8289730
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     8289730
Protein phosphatases and associated proteins [BR:rcu01009]
 HAD phosphatases
  Other HAD phosphatases
   8289730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 8289730
NCBI-ProteinID: XP_002532237
Position
Unknown
AA seq 279 aa AA seqDB search
MFGIEVSCKFWQNLQFRPFNNLAFASLQNLHKSRHQFAMANCSTNLSVKQPITHVVFDMD
GLLLDTEKFYTEVQEIILARYNKTFDWSLKPKMMGKKAIEAARVFVEETGISDSLSAEDF
IIEREEMLRSLFPTSELMPGVSRLIRHLHSKGIPIALATGSHRRHFELKTQRHGELFSLM
HHFVLGDDPEVKQGKPSPDVFLAAARRFEDGTVDPQKILAFEDAPTGVLAAKNAGMHVVM
VPDPRLDSSYHKNADQVLCSLLDFNPSYWGLPSFENSES
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaattgaagtctcctgcaaattttggcagaacctgcaatttagaccttttaac
aatttagcctttgcatctctacaaaatctccataaatccagacaccagtttgcaatggct
aattgttccactaacctttcagtaaaacaaccaataactcacgttgttttcgacatggat
ggcctcttacttgacacagagaaattctatactgaagtccaggaaattatactggctaga
tacaataaaacttttgattggtctctaaagcctaaaatgatggggaagaaagcaattgaa
gcagctcgtgttttcgttgaggagaccgggattagtgattccctttcagctgaggacttt
attattgaaagggaggagatgctacgaagcttgtttccgactagtgaactcatgccagga
gtcagccggttgatcaggcatctccactcaaaaggaataccaattgccttagcaactggt
tctcacaggaggcattttgaattgaaaacacagagacatggtgagcttttctccttgatg
catcattttgtccttggagatgatccagaagttaaacaaggaaaaccatcaccagatgta
ttccttgctgcagccaggagattcgaggatggcactgtagatccacagaagattcttgct
tttgaagatgcgcccacaggtgttcttgcagccaaaaatgctggaatgcatgtagtaatg
gttccagatccaagactggatagctcttatcacaagaatgctgaccaagttttgtgctct
ctattggatttcaacccgagttactggggcctgccgtctttcgaaaactcggaaagctaa

DBGET integrated database retrieval system