KEGG   Roseobacter denitrificans: RD1_0090Help
Entry
RD1_0090          CDS       T00376                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rde  Roseobacter denitrificans
Pathway
rde00300  Lysine biosynthesis
rde01100  Metabolic pathways
rde01120  Microbial metabolism in diverse environments
rde01230  Biosynthesis of amino acids
Module
rde_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RD1_0090 (dapE)
Enzymes [BR:rde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RD1_0090 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABG29826
RoseoBase: RD1_0090
UniProt: Q16DW7
Position
92563..93852
Genome map
AA seq 429 aa AA seqDB search
MQPDLAAAIENRRDDLIALTQALIRIPTLNPPGCEYHTICQLIASRLEARGFAIEMIRAR
GTPGDSDTYPRWNVVARHDGATQGECVHFNSHIDVVEVGQGWTHDPFAGTLQDGRIYGRG
ACDMKGGLAASIIAVEAFIDTYPDYAGAIEISGTADEESGGYGGVAYLAERGYFDPQRVQ
HAIIPEPLNKDRICLGHRGGWWAEIETHGEIAHGSMPFLGDCAVRHMGAVLSEFEDKLFP
AMALRRTDMPVVPDGARQSTMNINSIHGGQAEQDADFDGLPAHCVPDSCRIVIDRRFLLE
EPLDQVRAEVTGLLETLKQTRPDFEYTLTEINSVLPSMTDRDAPIVRVVAQAIEEVIGNP
PDYVASPGTYDQKHIDRIGKLKNCIAYGPGILELAHKPDEYVGVDDMIDSAQVMAQSLVT
LLTGKAQSV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacctcgccgcagccatagaaaacagacgagacgacctgatcgccctcacg
caggcgctgatccggatcccgacgctgaacccgccgggctgtgagtatcacacaatctgc
cagttgatcgcatcccgtcttgaggcgcgcggctttgccatcgagatgatccgcgccagg
gggacacccggcgacagtgacacatacccaaggtggaacgttgtagcccggcatgatggg
gccacacagggtgaatgcgtgcattttaacagccatatcgacgtggtcgaggtggggcag
ggctggacccatgacccctttgccggcacgctgcaggatggtcggatttatggccgcggt
gcttgtgacatgaagggggggcttgctgcgtcgatcatcgcggttgaagccttcatcgac
acctaccccgattacgccggtgccatcgaaatttcaggcacggcggatgaggaatcgggt
ggatatggcggtgtcgcctatcttgcagagcgggggtatttcgacccgcagcgtgtgcag
catgcgatcatcccggaacctttgaacaaggaccgcatctgccttgggcaccggggcggc
tggtgggcagagatcgaaacccatggtgaaattgcgcatggctccatgcctttcctgggc
gattgtgccgtgcgccatatgggtgcggtgctgtctgaattcgaagacaagctgttcccc
gccatggccctgcgtcgcaccgatatgcccgttgtgcccgatggcgcgcggcaatccacg
atgaacatcaattcgatccatggcggacaggccgaacaggatgccgattttgacgggctg
cccgcgcattgcgtaccggacagttgccgcatcgtgattgaccgccgtttcctgctggaa
gaaccgctggatcaggtccgtgccgaagtcaccggcctgcttgaaacccttaaacaaaca
cgcccggatttcgaatatacgctgaccgagatcaattctgtgctgccctcgatgaccgac
cgggacgcgccgattgttcgcgttgtggcacaggccatcgaagaggtgatcggcaacccc
ccggactacgtggcctcccccggcacctatgatcagaaacacatcgaccggatcggcaag
ctgaaaaactgtatcgcctatgggccgggtattctggagcttgcgcataagccggatgaa
tatgtcggcgtcgatgacatgatcgacagcgcgcaggtgatggcgcaatcgctggtcaca
ctgttgacgggcaaggcccagagcgtctga

DBGET integrated database retrieval system