KEGG   Roseobacter denitrificans: RD1_0126Help
Entry
RD1_0126          CDS       T00376                                 

Gene name
cycA
Definition
(GenBank) cytochrome c-551
  KO
K08738  cytochrome c
Organism
rde  Roseobacter denitrificans
Pathway
rde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_0126 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABG29861
RoseoBase: RD1_0126
UniProt: P07625
Position
complement(125920..126339)
Genome map
AA seq 139 aa AA seqDB search
MTRTLAVVLAMTFSAAPVFAEGDIEAGEKAFNKCKSCHQIVSDAGEEIVKGGRTGPNLYG
VLGRQAGTADFRYGDDLVAAGEAGLVWDADNFVEYVTDPRAFLRAYLDDSKAKSKMAYKL
RSGGEDIAAYLASVSGSSS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaactttagcagtagtactcgcaatgacattctcggcagctccggtattcgcc
gaaggtgacatcgaagcaggtgaaaaagcattcaacaaatgcaagtcctgccaccagatc
gtttccgacgccggcgaagaaatcgtgaagggcggccggaccggcccgaacctctatggg
gtcttgggtcgtcaggcgggcactgcggacttcagatacggcgacgaccttgttgccgcc
ggtgaagccggcttggtctgggatgcggacaactttgtggaatacgtcaccgatccgcgt
gcgttcctgcgcgcctatctggacgattccaaagcgaaatccaaaatggcatataagctg
agaagcggcggcgaagacatcgcggcctacctcgcatcggtgtccggcagctcaagctga

DBGET integrated database retrieval system