KEGG   Roseobacter denitrificans: RD1_0139Help
Entry
RD1_0139          CDS       T00376                                 

Gene name
bchN
Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
rde  Roseobacter denitrificans
Pathway
rde00860  Porphyrin and chlorophyll metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_0139 (bchN)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RD1_0139 (bchN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABG29874
RoseoBase: RD1_0139
UniProt: Q16DR9
Position
complement(140068..141354)
Genome map
AA seq 428 aa AA seqDB search
MTELPRLPAQGGCSNAPILKQRGQREVFCGLTGIIWLHRKMQDAFFLVVGSRTCAHLLQS
AAGVMIFAEPRFGTAILEETDLAGLADAQAELDKVVDQLLARRTDIKQLFLVGSCPSEVI
KLDLSRAAERMTEKYAPSVRVLNFSGSGIETTFTQGEDACLASMVPVLPKTDTRQLLLVG
ALPDVVEEQAVSLLEQMGIGPIKVLPAPRADTDLGIGENTVFALTQPFLGDTHGALERRG
ARHLPAPFPFGEEGTTAWLRVIADEFGVDADTFERVTAAPRARARKAISQASEALRGKTI
FFFPDSQLEIPLARFLTRECGMEAIEVGSPFVHKGIIGSDLEMLAQGPVISEGQDVDLQL
DRCRAARPDLTVCGLGLANPLEAEGLATKWAIELVFTPVHFYEQAGDLAGLFSRPVRRAG
LLKVEAAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacttccccgacttccagcccagggcggatgcagcaacgcaccgattctcaag
caacgtggccagcgcgaagtcttttgcgggctgaccggtatcatctggttgcaccgcaag
atgcaggatgcgtttttcctcgtcgtgggcagccgcacctgcgcacatcttttgcaatcc
gcggcaggggtgatgatttttgccgaaccgcgttttggcaccgccatcctcgaagaaacc
gatctggccggtcttgccgatgcgcaggctgaactcgacaaggtcgtggatcaactgctc
gcccggcgcacggatatcaagcaattgttcctcgtcggctcctgcccctctgaggtcatc
aaactggacctgtcgcgcgccgccgagcgtatgaccgagaaatacgccccctccgtgcgg
gtgctgaacttctccggctccggcattgaaaccacctttacgcaaggcgaggacgcctgc
ctcgcttccatggtgccggtcctgccgaaaacggatacacgccaactgcttctggtgggc
gctttgcctgatgtggtcgaggaacaagcggtttccctgctcgaacagatgggcattggc
ccgatcaaggtgttgccagccccgcgtgccgataccgatcttggcattggtgaaaacacg
gtttttgcgctcacgcagccctttctgggcgatacacatggtgcgcttgaacggcgcggt
gcacggcacttgccggcccccttcccctttggtgaagaaggcacgaccgcgtggctgcgc
gtcattgccgatgaatttggcgtcgatgccgacacattcgaacgcgtgaccgccgccccc
cgtgcccgcgcgcgcaaggccatttcgcaggcatctgaggccctgcggggcaagacgatt
ttcttctttcctgacagccagcttgaaatcccgctggcccgctttctgacccgcgagtgc
gggatggaggcgatcgaagtcggctcgcctttcgtgcacaaaggcatcatcgggtccgac
cttgagatgctcgcgcaaggccccgtgatatccgaagggcaggacgttgatctgcagctt
gaccgctgccgcgcggcccgccctgatctgacggtctgtgggcttggtcttgccaaccct
ctcgaagctgaggggctggccacaaaatgggccatcgagctcgtgttcacccctgtgcat
ttctacgaacaggccggtgatcttgccgggctcttttcccgtccggtgcgccgcgccgga
ttgcttaaagtggaggccgccgaatga

DBGET integrated database retrieval system