KEGG   Roseobacter denitrificans: RD1_0599Help
Entry
RD1_0599          CDS       T00376                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rde  Roseobacter denitrificans
Pathway
rde00480  Glutathione metabolism
rde00590  Arachidonic acid metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RD1_0599 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RD1_0599 (gpo)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RD1_0599 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABG30299
RoseoBase: RD1_0599
UniProt: Q16CJ4
Position
580959..581507
Genome map
AA seq 182 aa AA seqDB search
MKALKSTVAALVTAAFVAGPVCAGARDHQFASIDGGFVDMADWAGQPVLVVNTASQCGFT
GQYAGLQELYDTYRAAGLVVFAVPSDDFNQELGSAEEVKEFCEMNFGLDLPMADITRIRG
KNAHPFYQDVRAETGFVPRWNFNKVLIGPDGEIVDTWGSQTKPMSREITDAVETLLDQAS
QG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctgaaatcaacagtggcggcacttgtcacagccgcatttgtcgcaggtccg
gtctgtgcgggggcacgcgatcaccagtttgcgtccatcgacggcgggtttgtggacatg
gccgattgggcagggcagcccgtgctggtcgtcaacactgcctcgcaatgtggttttacg
ggccaatatgcggggctgcaggaactctatgacacctaccgcgcggccggtctggtggtt
tttgcggttccatcggatgatttcaatcaggaacttggcagcgcggaagaggtcaaggaa
ttctgcgaaatgaactttggactcgatctgccgatggcggatatcacccgcatccggggc
aagaacgcgcatccgttctatcaggatgtgcgtgcggaaaccgggttcgtgccgcgctgg
aatttcaacaaggtattgatcggtccggatggcgaaatcgttgacacctggggttcgcag
acaaaaccaatgtcgcgtgagattaccgacgcggttgaaacactattggatcaagcaagt
cagggctga

DBGET integrated database retrieval system