KEGG   Roseobacter denitrificans: RD1_1160Help
Entry
RD1_1160          CDS       T00376                                 

Gene name
mclA
Definition
(GenBank) malyl-CoA lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
rde  Roseobacter denitrificans
Pathway
rde00630  Glyoxylate and dicarboxylate metabolism
rde00660  C5-Branched dibasic acid metabolism
rde00680  Methane metabolism
rde01100  Metabolic pathways
rde01120  Microbial metabolism in diverse environments
rde01200  Carbon metabolism
Module
rde_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RD1_1160 (mclA)
   00660 C5-Branched dibasic acid metabolism
    RD1_1160 (mclA)
  09102 Energy metabolism
   00680 Methane metabolism
    RD1_1160 (mclA)
Enzymes [BR:rde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     RD1_1160 (mclA)
    4.1.3.25  (S)-citramalyl-CoA lyase
     RD1_1160 (mclA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: ABG30811
RoseoBase: RD1_1160
UniProt: Q16B32
Position
complement(1120047..1121024)
Genome map
AA seq 325 aa AA seqDB search
MSFHPVEQAPGRLNRSELAVPGSQPQMFEKAAQSDVDVIFLDLEDAVAPDEKEQARKNII
KALNEIDWGTKSMSIRINGLDTHYMYRDVVDVVEQAGERLDLIMIPKVGTAADVYAVDMM
VTQIEDAKGYSKRIGFEHIIETALGMQNVSEIAAASKRNESLHFGVADYAASTRARTTII
GGVNPDYSVLTDPDSDGNRATHWGDMWHYALARMVVAARANGLRPIDGPFGDFQDPDGYK
AAAYRAAVLGCEGKWAIHPSQIALANEVMSPSEAEITKAKRILEAMAQAEAEGKGAVSLD
GRLIDYASIRQAEVLVEKARQISGA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcattccatcctgttgaacaagctcccggtcgcctgaacagatcggagctggctgtt
cctggttctcagcctcaaatgtttgaaaaagcggcgcaatccgacgttgatgtgatcttt
ctggaccttgaggacgcggtcgctccggatgaaaaggaacaagcgcgcaagaacatcatt
aaggccctgaacgagatcgactggggcaccaaatccatgtcgattcggattaacggtctg
gacacacattacatgtatcgtgatgtcgtggacgtggtggagcaagccggagagcggctt
gacctcatcatgattcccaaggtcgggacggctgcggacgtctatgccgtggacatgatg
gtcacacagatcgaggacgcgaaagggtattcaaaacgcatcgggtttgaacatattatc
gagaccgctctggggatgcagaacgtctctgagattgccgccgcttcaaagcgcaacgaa
agcctgcatttcggtgtggccgattatgcggcctccacgcgcgcgcgcaccacgatcatt
ggcggcgtaaatccggactactccgtgctgaccgacccggacagcgatggcaatcgcgca
acccattggggtgacatgtggcactatgcgctcgcgcggatggttgtcgctgcacgtgcg
aacgggttgcgtcccatcgatggcccattcggtgattttcaggatcccgatgggtataag
gcggccgcctaccgcgcggcggtcctgggatgcgagggcaaatgggcgatccaccccagc
cagatcgcgctggcgaacgaggtgatgagcccgtccgaggctgaaatcaccaaggccaag
cgcattctggaagccatggcgcaggccgaggccgagggcaaaggcgccgtttcccttgac
ggccggctcatcgactacgcctccatccgacaggcagaagtcctcgtcgaaaaggcgcgg
caaatttcaggtgcctga

DBGET integrated database retrieval system