KEGG   Roseobacter denitrificans: RD1_1563Help
Entry
RD1_1563          CDS       T00376                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
rde  Roseobacter denitrificans
Pathway
rde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_1563 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ABG31191
RoseoBase: RD1_1563
UniProt: Q16A02
Position
complement(1485499..1485876)
Genome map
AA seq 125 aa AA seqDB search
MFQKLTAGLLALTLAAPAFASGDPASGEKVFRKCKACHAVGEDAKNKVGPTLNGIMGAAA
GANPDFKYSDALMTMAADGLVWTEEEMAAFLKKPKEYMPKTKMSFAGLRKDDDIADVIAY
LATFN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaaactcacagccggcctgctggccctgaccctcgcggcccccgccttcgcc
tcgggcgaccctgcgagcggcgaaaaggtctttcgcaaatgcaaagcctgtcacgccgtg
ggcgaggacgccaagaacaaggtgggcccgacgttgaacggcatcatgggggccgctgcg
ggggccaatcctgatttcaaatattcggatgcgttgatgacgatggccgctgacggtcta
gtctggaccgaagaggagatggcggcctttctcaagaaacccaaggaatacatgcccaag
accaagatgagctttgcgggccttcggaaagacgacgatatcgcggatgtcatcgcctat
ctcgcgaccttcaactga

DBGET integrated database retrieval system