KEGG   Roseobacter denitrificans: RD1_1615Help
Entry
RD1_1615          CDS       T00376                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rde  Roseobacter denitrificans
Pathway
rde00020  Citrate cycle (TCA cycle)
rde00640  Propanoate metabolism
rde00660  C5-Branched dibasic acid metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
rde01200  Carbon metabolism
Module
rde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RD1_1615 (sucC)
   00640 Propanoate metabolism
    RD1_1615 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RD1_1615 (sucC)
Enzymes [BR:rde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RD1_1615 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABG31242
RoseoBase: RD1_1615
UniProt: Q169V1
Position
complement(1557984..1559177)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGAPVSDGRVVLKAEDAKTAAGELDGPLWVVKAQIHAGGRGKGSFK
EADAGEKGGVRLTKSVAEAAEEAKKMLGRTLVTHQTGPAGKQVNRIYIEDGSGIETELYL
ALLVDRQTSRVSFVCSTEGGMDIEEVAASTPEKILSFSVDPASGYQAFHGRRIAFALGLE
GKQVKQCVGLMGLLYTAFMEKDMEMLEINPLIVTNTGDLKVLDAKVAFDGNAIYRHADIS
ELRDTTEEDSKELEASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPQVKGILVNIFGGIMRCDVIAEGVVAAVKEVGLKVPLVVRLE
GTNVQQGKDIINNSGLDVIAADDLKDGAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaataccaagccaaagccctcctccgcagctatggcgcaccggtctcc
gacgggcgggtcgtgctcaaggccgaagacgccaagacggcagcaggagagcttgatggt
ccgttgtgggtagttaaagcgcaaattcatgcgggcggtcgcggcaagggatcgttcaag
gaagccgacgccggtgaaaaaggtggcgtgcgcctgaccaaatccgtggcagaggcggcg
gaagaagccaagaaaatgctcggccgcacattggtgacgcatcagacaggccccgcaggc
aaacaagtcaatcgcatctacatcgaagatgggtcagggattgaaaccgaactctacctc
gcgcttttggtggaccgccaaaccagccgcgtcagctttgtctgctcaaccgagggcggc
atggacatcgaagaggtcgccgcttcaacgccggaaaaaatcctgtctttctccgtggat
cccgcgtccggctatcaggcgtttcacgggcgtcgcatcgcctttgcgctcggccttgag
ggcaagcaggtcaagcaatgcgtgggcctgatgggcctgctttataccgcgttcatggaa
aaagacatggaaatgctggaaatcaacccgctgatcgtcaccaataccggcgatctcaag
gtgcttgatgccaaggtggcttttgacggcaatgccatctaccgccatgccgacatttcc
gaactgcgcgacacgaccgaggaagacagcaaggagttggaagcctccaaatacgatctc
aactatatcgcgctggatggtgaaatcggctgcatggtgaacggcgcggggctggcgatg
gcgacaatggacatcatcaagctctatggcgcggaacctgcgaatttcctcgatgtgggc
ggtggtgcaaccaaggaaaaggtcaccgaagcgttcaagatcatcacttccgatccgcag
gtcaaaggtattctggtcaacatcttcggcggcattatgcgctgcgatgtaatcgccgag
ggcgtcgtcgctgcggtgaaagaagtcggcctgaaagtgccgcttgtggtgcgcctcgaa
gggacgaacgtgcaacagggcaaggacatcatcaacaactccggcctcgatgtcatcgcc
gccgatgacctcaaggacggtgcccagaaaattgtgaaagcggttaaaggttga

DBGET integrated database retrieval system