KEGG   Roseobacter denitrificans: RD1_2332Help
Entry
RD1_2332          CDS       T00376                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rde  Roseobacter denitrificans
Pathway
rde00010  Glycolysis / Gluconeogenesis
rde00620  Pyruvate metabolism
rde00640  Propanoate metabolism
rde00680  Methane metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
rde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_2332 (acsA)
   00620 Pyruvate metabolism
    RD1_2332 (acsA)
   00640 Propanoate metabolism
    RD1_2332 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RD1_2332 (acsA)
Enzymes [BR:rde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RD1_2332 (acsA)
Lipid biosynthesis proteins [BR:rde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RD1_2332 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABG31908
RoseoBase: RD1_2332
UniProt: Q167D5
Position
complement(2229120..2231090)
Genome map
AA seq 656 aa AA seqDB search
MSDTKNTPKSYPPSADMVANAHVTLSQYASLYSESVSDSEGFWRREGGRVDWIKPFTKVR
DVNFDLGSVSINWYGDGTLNVAANCVDRHLATRADQTAIIWEPDDPKDAAKHITYKQLHV
SVCKMANVLESLGVRRGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAARI
NGSDAKVVITADHAPRGGRATALKANTDAALLHCKDSVKCLVVKRTGGQTTWIDGRDFDC
GEMMLEASDVSHPAEMNAEDPLFILYTSGSTGQPKGVVHTSGGYLTYAAMTHEIVFDYHD
GDVFWCTADVGWVTGHSYIVYGPLANGATTIMFEGVPTYPDASRFWQVCEKHKVNQFYTA
PTAIRALMGQGKEFVEKCDLSDLKVLGTVGEPINPEAWNWYNDVVGKGKCPIVDTWWQTE
TGGHLMTPLPGAHTMKPGSAMKPFFGIKPMVLEPASGEVLEGNDVEGVLVIADSWPGQMR
TIWGDHERFEKTYFSDYKGYYFTGDGCKRDADGDYWITGRVDDVINVSGHRMGTAEVESA
LVAHAKVAEAAVVGYPHDIKGQGIYCYVTLMNGEEPSDELYQELRKWVRAEIGPIASPDL
IQWAPGLPKTRSGKIMRRILRKIAEDDFATLGDTSTLADPTVVDDLIKNRMNKQDA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacacgaaaaacaccccgaaatcctatccgccatccgctgacatggtggcaaat
gcccacgtcaccttatcgcaatacgcgtctctttattcggagtctgtttcggattctgag
gggttttggcggcgtgagggggggcgggttgactggatcaagccgttcaccaaggtcagg
gatgtgaacttcgatctcggctctgtgtcgatcaactggtacggcgatgggacgttgaat
gtggcggccaattgcgtcgatcgccatctggccacgcgcgccgatcagaccgcgatcatc
tgggagccggatgaccccaaggatgccgccaaacatatcacctacaagcaattgcatgtt
tcggtctgcaagatggccaatgtgctggaaagccttggcgtgcggcgcggcgaccgggtg
gtgatctacctgccgatgatccccgaggcggcctatgcgatgctggcctgtgcgcgcatc
ggcgcgatccactccatcgtctttgccgggttctcgcccgatgcacttgccgcgcggatc
aatggcagtgacgccaaagtcgtcatcaccgccgatcacgccccgcgcggcgggcgcgcc
acagcgctcaaggccaatacggatgcggccctgctgcactgcaaggacagcgtgaagtgc
ctcgtcgtcaagcgcacaggcgggcagaccacctggatcgacgggcgcgattttgactgc
ggcgagatgatgctggaggcctccgatgtctcccaccccgccgagatgaacgccgaagac
ccgctgttcatcctctatacctccggctccaccgggcagcccaagggcgtcgtgcacacc
tcgggcggctatctcacctatgccgcgatgacccatgagatcgtgtttgattaccacgat
ggcgatgtgttctggtgcaccgccgatgtgggctgggtgacgggccacagctatatcgtc
tacgggccgctggccaatggcgcgaccaccatcatgttcgagggcgtgccgacctacccc
gatgccagccgcttctggcaggtctgcgaaaagcacaaagtcaaccagttctacaccgcc
cccaccgccatccgcgcgctgatgggacagggcaaggagttcgtcgaaaaatgcgatctg
agtgatctcaaggtgctgggcaccgtgggcgagccgatcaaccccgaggcctggaactgg
tacaatgacgtggtgggcaagggcaaatgccccatcgtcgacacctggtggcagaccgaa
acaggcgggcatctgatgacccctctgcccggcgcgcataccatgaaaccgggctcggcg
atgaagcctttctttggcatcaagccgatggtgctggagcctgcgtcaggcgaggtgctg
gagggcaacgacgtcgagggcgtgctggtcatcgccgacagctggcccggccagatgcgc
accatctggggcgatcacgaacgcttcgaaaagacctacttctctgattacaaaggctat
tacttcaccggagatggctgcaagcgcgacgcggacggcgattactggatcacgggacgg
gtcgatgacgtgatcaacgtctcgggccaccgcatgggcaccgcagaggtcgaaagcgcg
ctggtcgcccacgccaaagtcgccgaagccgccgttgtcggatacccgcatgacatcaag
ggacagggcatctactgctacgtcacgctgatgaacggcgaagagcccagcgatgagctc
tatcaggaattgcgcaaatgggtccgcgcagaaatcggccccatcgcatccccagacctc
atccaatgggcccccggcctgcccaaaacacgctccggcaaaatcatgcgccgcatcctg
cgcaaaatcgccgaagacgacttcgcaaccctcggagacacctcaacactcgcagaccca
accgtcgtagatgacctcatcaaaaacagaatgaacaaacaggacgcttga

DBGET integrated database retrieval system