KEGG   Roseobacter denitrificans: RD1_3525Help
Entry
RD1_3525          CDS       T00376                                 

Gene name
ltaE
Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rde  Roseobacter denitrificans
Pathway
rde00260  Glycine, serine and threonine metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
rde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RD1_3525 (ltaE)
Enzymes [BR:rde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RD1_3525 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 ELFV_dehydrog_N Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABG33007
RoseoBase: RD1_3525
UniProt: Q162T6
Position
3386574..3387611
Genome map
AA seq 345 aa AA seqDB search
MYLASDNTGPAHPQVMEHVLAANEGYAMPYGADPIMERVRDRMRDVFEAPDAAVYLVATG
TAANALALACYGQPWQTVFCSPVAHIHEDECNAPEFYSAGSKLTLVPGSDRMTPDALRSS
IETEESRGVHGPQRGPVSITQVTERGGVYTLDEITSLTDVAKHYGLPVHLDGARFANAMV
ALECSAAEMTWKRGVDVVSFGGTKNGCLGVEAVVFFDPDKAWEFELRRKRGAHLFSKHRF
LSAQMEGYLKNDIWLDMARQSNARAAQLSAGLLEKGAHFLHAPDANMIFASFPRRIHQRL
HDAGAKYYIWSGNLEGDDPDALLAARLVCDWSLSEEHIAEFLSHF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcgcctctgacaacaccggacccgcacacccgcaagtgatggaacatgtgctg
gctgccaatgaaggctacgctatgccctacggcgcagacccgatcatggaacgcgtgcgt
gacaggatgcgcgatgtctttgaagccccggatgcggcggtctatctggtcgccactggc
acagcggccaatgcgctggcgctggcgtgttatggtcagccgtggcagacggttttctgc
tcaccagtggcgcatatccacgaggatgaatgcaacgcgcctgaattttacagtgcgggc
agcaaactcaccctcgtgcccggttcggacaggatgacaccggatgcactgcggtcatca
atcgaaacagaggaaagccgcggcgtgcacgggccgcagcgtggtcccgtctcgatcaca
caggtcacggaacgcggcggtgtctacacccttgatgagattacctccctcacggatgtt
gcaaaacactatggtctgcctgtgcatctggacggggcacggtttgcaaatgccatggtg
gcgctggaatgttcggctgctgaaatgacgtggaaacgcggcgtcgatgtcgtcagcttt
gggggtacgaaaaacggctgtctgggggtggaggccgtcgttttctttgaccctgacaaa
gcctgggaattcgaattgcgccgcaaacggggcgcgcatcttttctcaaaacaccgcttt
ttatctgcccagatggaagggtatctgaaaaacgatatctggctggatatggcgcgccaa
tccaatgcgcgcgcggcacagctcagcgcggggctgttggaaaaaggcgcgcatttcctc
catgcgcctgatgccaatatgattttcgcaagtttcccgcgccggatacaccagcgcctg
catgacgcgggcgcgaaatactacatctggtccggaaatctggaaggggatgacccggac
gcgttgctcgccgcccgcctcgtttgtgattggtccctgagcgaagaacacatcgctgag
ttcctaagccatttttag

DBGET integrated database retrieval system