KEGG   Roseobacter denitrificans: RD1_3972Help
Entry
RD1_3972          CDS       T00376                                 

Gene name
fadA
Definition
(GenBank) fatty acid oxidation complex beta subunit
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rde  Roseobacter denitrificans
Pathway
rde00071  Fatty acid degradation
rde00072  Synthesis and degradation of ketone bodies
rde00280  Valine, leucine and isoleucine degradation
rde00310  Lysine degradation
rde00362  Benzoate degradation
rde00380  Tryptophan metabolism
rde00620  Pyruvate metabolism
rde00630  Glyoxylate and dicarboxylate metabolism
rde00640  Propanoate metabolism
rde00650  Butanoate metabolism
rde00900  Terpenoid backbone biosynthesis
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
rde01200  Carbon metabolism
rde01212  Fatty acid metabolism
rde02020  Two-component system
Module
rde_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD1_3972 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RD1_3972 (fadA)
   00640 Propanoate metabolism
    RD1_3972 (fadA)
   00650 Butanoate metabolism
    RD1_3972 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    RD1_3972 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RD1_3972 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RD1_3972 (fadA)
   00310 Lysine degradation
    RD1_3972 (fadA)
   00380 Tryptophan metabolism
    RD1_3972 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RD1_3972 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RD1_3972 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RD1_3972 (fadA)
Enzymes [BR:rde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RD1_3972 (fadA)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD1_3972 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABG33426
RoseoBase: RD1_3972
UniProt: Q161B7
Position
3829356..3830567
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDALRTPRGKGRKDGSLHEVTSLRLSALTLNALKDRNNLEGHAVEDVIWGNVTQ
VMEQGGCLARSAVLASDLDERIPGLAINRFCASGMEAVNLAANQVRGGAGQAYIAGGVEM
MGRVAMGSDGAAIAVDPTLAMEKHFVPQGISADIIATEYGFSRDDADTLAVESQRRAKQA
WDEGRFDKSVIEVRDQNGLKILDHDEYMRPQTDMQSLGALNPAFQAMGEVMPGFDKVALM
KYPHLERINHIHHAGNSSGIVDGAAAVLIGNKEFGEEHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILADSGMDIKDIDLFEVNEAFAAVVLRFLQAFDVDDAKVNVNGGSIAMGHP
LGATGAIIIGTLLDELERDDKEVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctatatctatgacgcgctgcgcaccccgcgtggcaagggccgcaaggac
ggcagcctgcacgaggtgacatccctgcgcctgtccgcgctgacgctgaacgcgctgaag
gaccgcaacaaccttgagggccacgctgttgaggatgtgatctggggaaatgtgacacag
gtgatggaacagggcggctgccttgcgcgctctgccgtgttggcgtccgatctggatgaa
cgcatccccggtctggcgattaaccgcttttgcgcctctggcatggaggcggtcaacctc
gccgccaatcaggtgcgcggtggtgccggtcaggcctacatcgcgggcggggtcgagatg
atgggccgtgtggccatgggcagtgacggggcggccatcgcggttgatccgacgctcgca
atggaaaaacacttcgtcccccaaggcatcagcgcggatatcatcgcgaccgaatatggc
tttagccgcgatgatgcggacacgctggcggtcgaatcccagcgtcgcgcaaaacaggca
tgggatgaggggcgttttgacaaatcggtcatcgaggtgcgcgaccagaacgggctgaag
attctggatcacgacgaatacatgcgcccgcaaaccgacatgcaaagccttggcgcgctg
aaccccgcctttcaggcgatgggagaggtcatgcccggcttcgacaaggtcgcgctgatg
aaatacccgcatcttgagcggatcaaccatatccaccacgcgggcaactcatcgggtatc
gtcgatggggcggcagccgttctgatcggcaacaaagagttcggcgaagagcacggactg
aagccgcgcgcccgcatccgcgccacggcgaaaatcggcaccgaccccacgatcatgctg
accggtcctgtgccggtgaccgaaaaaatcctcgccgacagtgggatggacatcaaggac
attgatctttttgaggtgaacgaggcctttgccgccgtggtgctgcggtttttgcaggcg
tttgatgtcgatgatgcgaaggtgaacgtcaacggcggctcgatcgccatgggccatccg
cttggcgcgaccggggccatcatcatcggcacgctgctggatgagttggagcgcgacgac
aaagaggtcggtctggctacgctctgcatcgcctccggcatgggtgccgcgaccatcatc
gagcgcgtttaa

DBGET integrated database retrieval system