KEGG   Rhizorhabdus dicambivorans: CMV14_10555Help
Entry
CMV14_10555       CDS       T05084                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rdi  Rhizorhabdus dicambivorans
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CMV14_10555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ATE64783
UniProt: A0A2A4FPT2
Position
2225206..2225604
Genome map
AA seq 132 aa AA seqDB search
MKALFPHVAQTRGVVVRVAVSFMPEQSEPARGRWFWSYHIRIENEGHQAVQLLTRHWLIT
DGRGVKHDVRGEGVVGEQPVVEPGQSYDYVSGCPLQTATGSMEGSYHMVAEDGSTFEAAI
PRFPLIGPAVAI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctcttcccgcatgtcgcccagacgcgcggcgtcgtagtgcgggtcgcggtg
tccttcatgcccgaacagtcggagccggcgcgcggccgctggttctggtcctatcatatc
cggatcgagaatgaggggcaccaggccgtccaactgctcacccgccactggctgatcacc
gacgggcgcggcgtgaagcacgacgtgcgcggcgagggcgtggtcggcgagcagccggtg
gtcgagccgggccagagctacgattatgtctcgggctgcccgctgcagaccgcgaccgga
tcgatggagggcagctaccatatggtcgccgaggacggatcgaccttcgaggcggccatc
ccgcgcttcccgctgatcggcccggcggtcgcgatctga

DBGET integrated database retrieval system