KEGG   Rhizorhabdus dicambivorans: CMV14_16820Help
Entry
CMV14_16820       CDS       T05084                                 

Definition
(GenBank) 3-oxoacyl-ACP reductase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi00984  Steroid degradation
rdi01100  Metabolic pathways
rdi01120  Microbial metabolism in diverse environments
rdi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CMV14_16820
Enzymes [BR:rdi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     CMV14_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S15 Ndr DLH
Motif
Other DBs
NCBI-ProteinID: ATE65858
UniProt: A0A2A4FZ25
Position
complement(3587116..3587979)
Genome map
AA seq 287 aa AA seqDB search
MATEAPVLDTAFPVGKFARVWNGEYRLHYHELNRPNGRPSLLFLHGSGPGASGYSNFRHN
YPVMAEAGYHVIAVDYLGYGHSDKPRDFDYSTENQVSMLHELMQQLGVSQVIPVGNSLGG
FYGHAYALTYPNEVPKIISMAPGGVHEESTRPFSPGLQAMVAAVAKGPQNFTRESFRELL
KLIVKDERHLTDQVISERLPIAQSQPIEIYTRAIHRPVWERLHEIKVPVLAFWGYHDQFL
SVNHAFIMQEKIEHCRVIISNQAGHWFMIEEAELFNSACLAFLAEQG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaggcgcccgtgctggacacggcctttccggtaggcaagttcgcccgggtg
tggaacggcgaatatcggctccactatcatgagctgaaccgcccgaacggccggcccagc
ctgctattcctgcacggcagcgggccgggcgccagcggctacagcaatttccgccataat
tatccggtgatggccgaggccggatatcatgtgatcgcggtcgattatctgggctatggc
cattcggacaagccgcgcgacttcgactacagcaccgagaatcaggtctccatgctgcat
gaactgatgcagcaattgggcgtcagtcaggtcatcccggtcggaaactcactgggcggt
ttctatggccacgcctatgcgctcacatatcccaacgaggtgccgaagatcatctcgatg
gcgccgggcggcgtccatgaggaaagcacccggccgttctcacccggattgcaggcgatg
gtcgcggcggtggccaagggcccgcagaacttcacccgggaaagcttccgcgaactgctc
aagctgatcgtcaaggacgagcgccacctgaccgatcaggtgatctccgaacgcctgccg
atcgcgcagagccagccgatcgagatatacacgcgcgcgatccaccgtccggtgtgggag
cggctgcacgagatcaaggtgccggtgctcgccttctggggctatcatgaccagttcctg
tcggtgaaccacgccttcatcatgcaggagaagatcgagcattgccgggtgatcatatcg
aaccaggccggccattggttcatgatcgaggaggccgagctgttcaacagcgcctgcctc
gccttcctggcggagcaaggatga

DBGET integrated database retrieval system