KEGG   Rhizorhabdus dicambivorans: CMV14_16905Help
Entry
CMV14_16905       CDS       T05084                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
rdi  Rhizorhabdus dicambivorans
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMV14_16905
Enzymes [BR:rdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     CMV14_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ATE65874
UniProt: A0A2A4FZ43
Position
complement(3606013..3608112)
Genome map
AA seq 699 aa AA seqDB search
MGGAGMKAVKAGAKYSAVALAAALLVSARPAPPPIEWPVYGRTNAALRFAPIDQIDKANV
GSLGLAWYQQLDTDRGQESTPIMVGGVLYVSTAWSKVFAFDARTGKRLWGFDPEVPPATL
PKGCCDAINRGVSVANGRVYVGTLDGRLIALDATTGRKLWSVVTVDQSKPYTITGATMTV
GRLVLIGNAGAEYGVRGYLSAYDGATGRLVWRFYTVPNPDGKPDGQPSDKPLRELAEPGW
FGDVWRKAGGGGTVWDSMAYDAETGILYFGVGNGGPYDWHIRSQGKGDNLFLSSIVAVKA
ATGEYLWHYQTTPEDSWDFTATQQITLLDADFKGRPRKLLLQAPKNGFFYILDRITGELL
SAEPYAKVNWANGVDMKTGRPNIVPGAHYQEKPFLQSPSGLGAHSWHPMAYSPQTRLMYI
PTQVMSQLYARSTDFTYRPGHMNVAIDTRTLAVPDDPALLAQMKASIYGELIAWDPFEHK
IRWRVKHPSMLNGGVLATAGGLVFQGDAEGHLNAYDASTGERLWSYRTVNGIVAPPISYA
LDGRQYVAVMVGYGGPTAMYGTIVPYRPRLPGRLMVFALGGKTKAKPYDIPAPVPVNVAG
VSSAGDPVRGLAAYNDTCLVCHGFSATGRYTADLRRSETIKDADIFRGVVLDGAFEQKGM
VSFAQYVSPERAEDIRAYLLQEARKLVDRGDPDAKTAPR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagcgggcatgaaggccgtcaaggcaggggcgaaatattcggcggtggcgctg
gcggctgcactcttggtgtcggcccggcccgctccgccgcctatcgagtggccggtctat
ggacgcaccaacgcggcgctgcgcttcgcgcccatcgatcagatcgataaggccaatgtc
ggttcgctcggcctcgcctggtatcagcagctcgataccgaccgcgggcaggaatcgacc
ccgatcatggtcggcggtgtgctctatgtcagcaccgcctggtcgaaggtgttcgctttc
gatgcgcgcaccggcaagcggctatggggtttcgatcccgaagtgccgcccgcgaccttg
cccaaggggtgctgcgacgcgatcaaccggggcgtctccgtggcgaacggccgggtctat
gtgggtacgctcgacggccggctgatcgcgcttgatgccacgacggggcgcaagctctgg
tcggtcgtcaccgtcgaccagtcgaaaccctacacgatcacgggtgccacgatgacggtg
ggcaggctggttttgatcggcaatgccggcgccgagtatggggtgcgcggctacctctcc
gcctatgacggcgccaccggccggctggtctggcgcttctacaccgtgccaaatccagat
gggaagccggacggccagccttcggacaagcccttgcgggaactggccgaacccggctgg
ttcggcgacgtttggcgcaaggctggcggcggcggcaccgtgtgggattcgatggcttat
gatgccgagacgggcatcctctatttcggtgtcggcaatggcggcccctatgactggcat
atccgctcgcagggcaagggcgacaatctctttctgtcgtcgatcgtcgcggtgaaggcg
gcgacgggcgaatatctatggcattaccagacgacgcccgaggacagctgggatttcacc
gctacgcagcagatcaccctgctcgatgccgatttcaagggcaggccgcgcaagctgctg
ctccaggctccgaagaacgggttcttctacattctggatcggataaccggcgaactgctc
tccgccgaaccctatgccaaagtgaactgggcgaacggcgtcgacatgaagaccggcagg
ccgaacatcgtgcccggtgcccattatcaggaaaagccgttcctgcagtcgccctcgggt
ctcggcgcgcacagctggcatccgatggcgtacagcccgcagacgcggctgatgtatatt
cccacccaggtgatgtcgcagctctatgcgcgatcgacggatttcacctaccggcccggc
catatgaacgtggcgatcgacacgcgaactttggcggtgcccgacgatccggccctgctc
gcgcagatgaaggcctcgatctatggcgaactgatcgcgtgggatccgttcgagcacaag
atacgctggcgggtgaagcatccgtcgatgctcaacggcggggtgctggcgacggcgggc
ggcctggtcttccagggcgatgcggagggccacctcaacgcctatgacgcgtcgaccgga
gagagactctggtcgtaccgaaccgttaacgggatcgtcgcgccgccgatcagctatgcg
ctcgatggccggcaatatgtcgcggtgatggtcggctatggcgggccgaccgcgatgtac
ggcacgatcgtaccctatcggccgcgcctgcccggccggctgatggtgttcgctttgggg
ggcaagacgaaggcgaagccctatgacatccccgcgccggtgccggtcaacgtcgccggt
gtcagttcggcgggcgatccggtgcgcggtctggcggcgtataacgacacctgcctggtc
tgccacggcttcagcgccaccggccgctacaccgccgacctgcgccgctcggagaccatc
aaggacgcggatatatttcgtggtgtggtgctggatggcgccttcgagcagaagggcatg
gtgagtttcgcgcaatatgtctcgcccgaacgggccgaggatattcgcgcctacctgctc
caggaagcgcgcaagctggtcgatcgcggcgatccggacgcaaaaacggcgccgcgctga

DBGET integrated database retrieval system