KEGG   Rhizorhabdus dicambivorans: CMV14_23105Help
Entry
CMV14_23105       CDS       T05084                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi00740  Riboflavin metabolism
rdi00790  Folate biosynthesis
rdi01100  Metabolic pathways
rdi01110  Biosynthesis of secondary metabolites
rdi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CMV14_23105 (ribA)
   00790 Folate biosynthesis
    CMV14_23105 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CMV14_23105 (ribA)
Enzymes [BR:rdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CMV14_23105 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ATE66941
UniProt: A0A2A4FWU2
Position
complement(4897192..4898253)
Genome map
AA seq 353 aa AA seqDB search
MSMARDAARAIDALKRGWPVAVSAGGKRLVALAIETANDVTLADFDTGGAADVLLSATRA
ETLRLANQREAANPASPALVERVPWLDLPVAIALADPVRDLATPLKGPFRAKAVEAPEAA
EAALRLARLAGLLPALFVKNDGAAEAELSAEALDDYEDPAHLVIASQARLPVAVSEKAEI
VAFRHVADAAEHVALIIGTPDGTPPLVRLHSECLTGDVLGSLKCDCGPQLGGALAAMTEA
NWGILLYLRQEGRGIGLINKLRAYALQDQGFDTVDANLRLGFGVDERDFRVAARMLSLLG
QLRVRLLTNNPQKVAGLEGAGIEVVERVAHRMGENPHNSAYLATKRDRTGHVL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatggcccgcgacgccgcccgcgccatcgatgcgctcaagcgcggctggccggtc
gcggtgtcggccgggggcaagcggctggtcgccctggcgatcgagacggccaatgacgtc
accctcgccgatttcgatacgggcggcgctgccgacgtcctgctttccgccacgcgggcc
gagacattgcgtctcgccaaccagcgtgaggcggccaatccggccagcccggcgctggtc
gaacgcgtgccgtggctggacctgccggtggcgatcgcactggccgatccggtgcgcgac
ctggcgaccccgctgaagggaccgttccgcgccaaggcggtcgaggcgccggaggcggcc
gaggcggcgctccggctggcgcgcctcgccgggctgctgccggcgctgttcgtgaagaat
gacggggcggccgaggccgagctgtcggccgaggcgctcgacgattatgaggacccggcg
catctcgtcatcgcctcgcaggcgcgcttgccggttgcggtcagcgagaaggccgagatc
gtcgccttccgccatgtcgccgacgccgccgagcatgtcgcgctgatcatcggcacgccc
gacggtaccccgccgctggtccgcctccacagcgaatgcctgaccggcgacgtgctgggc
tcgctcaaatgcgattgcgggccgcagcttggcggcgcgctggcggcgatgaccgaggcc
aattggggtatcctcctctatctgcgtcaggaagggcgcggcatcggcctgatcaataaa
ctgcgcgcctatgccttgcaggatcagggcttcgacacggtcgacgccaatctccggctg
ggcttcggggtggacgagcgcgatttccgggtggcggcgcggatgctgtcgctgctcggc
cagctcagggtccggctgctcaccaacaatccgcagaaggtcgccggcctcgaaggcgcg
gggatcgaggtggtcgagcgggtggcgcaccgcatgggcgagaatccgcacaacagcgcc
tatctcgccaccaagcgcgaccgcaccggccacgtcctgtga

DBGET integrated database retrieval system