KEGG   Rothia dentocariosa: HMPREF0733_10132Help
Entry
HMPREF0733_10132  CDS       T01343                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00300  Lysine biosynthesis
rdn01100  Metabolic pathways
rdn01120  Microbial metabolism in diverse environments
rdn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0733_10132 (dapE)
Enzymes [BR:rdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF0733_10132 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADP39590
UniProt: E3H4X1
Position
complement(154865..155998)
Genome map
AA seq 377 aa AA seqDB search
MTISLDLNVSMPELTRTLLDIYSVSGEEKTIADAVYESLSAYPHLHLTRDGDAMIARTEF
GPRNGEERTRILLAGHLDTVPLPKVAGSLGTVPASIVEDNGDWILYGRGATDMKGGVAVQ
LKLAAELGEHDTDYNLTYVFYDHEEVASELSGMARLIRNHGELLTDADFGVLLEPTDGTI
EGGCNGTMRFYLRTAGLAAHSGRAWKGENAIHKLAGALRVLEEYEPQTYKVEGLAYREGL
NAVQVSGGVAGNVIPDAAALHINYRFAPNKTLDEAKAHVTEIFDGYELDFVDLSPAARPG
LDTPLAASLIAAVGQEPKPKYGWTDVARLSEIGIPAVNFGPGDALLAHTDNEHVSFSALT
RCYTDLLFWLHTEVDED
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcgcttgatctgaacgtttcgatgcccgaactcacccgcacgctccttgat
atttattcggtctccggggaagaaaaaactattgcagacgccgtttatgaatccctcagt
gcatatccgcatctgcatctcacccgtgatggtgacgctatgatagcccgtaccgaattt
ggcccccgcaacggtgaggaacgcacgcgcattttgctggctggtcacctggataccgta
cctctgcccaaggttgcgggatcgctcggaaccgtacccgcaagcattgttgaagataac
ggggactggattctctacgggcgcggtgccaccgatatgaagggcggcgttgcggtgcag
ctcaaattggcggcagaactgggcgagcacgataccgactacaacctcacctacgtgttc
tacgatcatgaggaagtcgccagcgaactttccggcatggcgcggctcattcgcaaccac
ggtgaacttctgactgacgctgattttggtgtgctcttggaacccaccgacggcactatt
gagggcggatgcaatggtacgatgcgtttctacctgcgcaccgccgggctcgcggcgcac
tccgggcgtgcctggaagggtgaaaacgcgatccacaaacttgctggggcgctgcgtgtt
ctggaggaatacgagccgcaaacttacaaggttgaggggctagcgtaccgtgaagggctc
aacgccgttcaggtttccgggggagtcgccgggaacgttattcccgatgctgccgccctg
cacattaactacaggtttgccccgaataagaccctggatgaggcaaaagcgcacgttact
gaaattttcgacggctatgagctcgacttcgtagacctttctccggcggcgcggcccgga
ttagataccccgctggcggcatcacttatcgcggctgtcgggcaggaacccaaacccaaa
tacgggtggacagacgtggcacggctcagcgagatcggtattcctgcggtgaattttggt
cccggcgatgcgctccttgctcacaccgacaacgagcacgtgagcttcagcgcgcttacc
cgctgctataccgatctgcttttttggctgcataccgaagtcgacgaagactag

DBGET integrated database retrieval system