KEGG   Rothia dentocariosa: HMPREF0733_11029Help
Entry
HMPREF0733_11029  CDS       T01343                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00010  Glycolysis / Gluconeogenesis
rdn00071  Fatty acid degradation
rdn00350  Tyrosine metabolism
rdn00625  Chloroalkane and chloroalkene degradation
rdn00626  Naphthalene degradation
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11029 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0733_11029 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0733_11029 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0733_11029 (adhP)
   00626 Naphthalene degradation
    HMPREF0733_11029 (adhP)
Enzymes [BR:rdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0733_11029 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADP40486
UniProt: E3H3U4
Position
complement(1099901..1100929)
Genome map
AA seq 342 aa AA seqDB search
MKAVVVPDVVDGSINVTDVPVPEVGHGQALVKLEYSGVCHTDLHVAAGDFGKVPGRVLGH
EGIGIVTEVGEGVESLKPGDRVSIAWFFQGCGHCEYCTSGRETLCRTVKNAGYTVDGAMS
EYALVAADYAVKVPEGLDAAQASSITCAGVTTYKAIKESQIRPGQWLVAYGAGGLGNLAV
QYAKKVFGAKVIAVDINDDKLKLAAETGADVTINGREVEDVPAKVREVTDGGAQAAVVTA
VSRVAFNQAVESVRAGGSVVAVGLPPEKMELSIAKVVLDGIRVLGSLVGTRQDLAEAFQF
GADGLVVPVVQLRKVDEAPQVFEEMNAGKINGRMVLDFASLW
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtagttgtccctgacgttgttgatggctcgataaatgtcaccgatgttccc
gtgcccgaggtggggcacggtcaggcgctcgtgaagctagagtactccggcgtctgccac
accgacctgcacgttgcggctggcgatttcggtaaggttccggggcgcgtcctggggcat
gagggtattggtattgtcaccgaagttggtgaaggcgttgaatcgctcaagcccggtgac
cgtgtctctattgcatggttcttccagggatgcgggcactgcgaatactgcacctccggc
agggagaccctatgccgtaccgtcaagaatgcgggctacaccgtggacggtgccatgagt
gagtatgcccttgtcgcggcagactatgccgtaaaggttcccgaaggtctggatgcggcg
caggcaagctcgattacctgcgcgggcgtaaccacctataaggcgattaaggaatcgcag
atacgccccggtcagtggctggtcgcctacggcgctggcgggctgggcaacttggcggtg
cagtacgccaagaaggttttcggtgccaaggttattgccgtcgatattaacgatgacaag
ctgaagcttgccgccgaaaccggtgccgacgtcacgattaacggtcgtgaggttgaggat
gtaccggcgaaggttcgtgaggtaactgacggcggggcgcaagctgccgtggtgaccgcg
gtatcgagggtcgcttttaaccaggcggttgagagcgtgcgtgccgggggcagcgtggtg
gctgtgggtcttccgcccgagaagatggagctatctatcgcgaaggtcgttcttgacggt
attcgcgtgctcggctcgttggttggcacccgtcaggatcttgctgaggcgttccagttc
ggcgcagacgggctggtggttcccgtagtgcagctgcgcaaggttgatgaggctccgcag
gtcttcgaagagatgaacgcaggcaagatcaacgggcgtatggtgctcgatttcgcaagc
ctgtggtaa

DBGET integrated database retrieval system