KEGG   Rothia dentocariosa: HMPREF0733_11360Help
Entry
HMPREF0733_11360  CDS       T01343                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rdn  Rothia dentocariosa
Pathway
rdn00020  Citrate cycle (TCA cycle)
rdn00190  Oxidative phosphorylation
rdn00650  Butanoate metabolism
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01200  Carbon metabolism
Module
rdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rdn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_11360 (sdhD)
   00650 Butanoate metabolism
    HMPREF0733_11360 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HMPREF0733_11360 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1691
Motif
Other DBs
NCBI-ProteinID: ADP40817
UniProt: E3H5I4
Position
1482470..1482955
Genome map
AA seq 161 aa AA seqDB search
MSTPLKSRVSVPRLRDNKIDGVKYNRSSSKRNNFEMFAWLGMRLSGVVLVVLIFGHLFVN
LMVGDGIHAIDFGFVGGKWANPFWQIWDLLLLWLAMLHGTNGIRVVIDDYAEKDRVRVWL
KIILFAASAFVLLVGTLTIFAFDPCPSGAAANLLPSFCPAH
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctactccactcaaatcacgcgtttcggttcctcgcctgcgcgataacaagattgat
ggtgtgaaatataaccgctcctccagcaagcgcaacaactttgaaatgttcgcctggctg
gggatgcgcctctccggcgtcgtgttggttgtcctgattttcgggcacctctttgtgaac
ctcatggtgggggacggcattcacgcgatcgacttcggcttcgtgggcggtaaatgggca
aaccccttctggcaaatctgggatctgctgctgctgtggctggctatgctccacggcacc
aacggcatccgcgtggtcattgacgactacgccgaaaaggatcgtgtgcgtgtgtggctg
aagatcattctcttcgcagcatccgcttttgtgctgctggttggaaccctcacgatcttt
gcttttgatccctgcccctcgggcgcggcggctaatctgctgcctagcttctgcccggcc
cactaa

DBGET integrated database retrieval system