KEGG   Rothia dentocariosa: HMPREF0733_11915Help
Entry
HMPREF0733_11915  CDS       T01343                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0733_11915
Enzymes [BR:rdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HMPREF0733_11915
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HMPREF0733_11915
    1.1.1.-  
     HMPREF0733_11915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 AdoHcyase_NAD ADH_N_2 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADP41372
UniProt: E3H2D9
Position
complement(2134745..2135827)
Genome map
AA seq 360 aa AA seqDB search
MKAARFYDRNDIRIEDIPAPEVQPGEVLVKVAWCGICGTDLHEYLDGPIFCPKHGHPHPI
SGEDSPVTLGHEFSGIVEALGEGISDLEVGDHVVVEPYIIADSVDVGPDSKTYHLSKNMN
FIGLAGRGGGLSEKVSVKRRWVHKISKDLPLDEAALIEPLSVGYHAVERAGEIKDGDFAL
VTGAGPIGLLTSAVLKAKGAKVIISELSSLRRQKALDSGVADYAFSPAEVDVLAEIHKLT
DDKGVDVAFECTSVQPALDLILDALKPTGKAVIVSIWGKPASLDVQKVVLKELDIRGTIA
YVNSHPETIKLVESGKINLKPFITGRIPLEDLIDKGFDTLINHNETAVKILVTTDPQLLP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctcgtttttacgaccgtaatgacattcgcattgaggacatacccgccccc
gaagtacaacccggtgaagtgttggtcaaagtagcatggtgtggtatctgtggcactgat
ttgcacgagtatcttgatgggcctattttctgccctaaacatgggcatccgcatccaatc
tcaggagaagattctcctgtaacccttggtcacgaattctcaggcatcgtagaagcttta
ggcgaaggcatttccgatcttgaagtcggagatcatgttgtggttgagccatacattatt
gcagactctgtagatgtcggcccagattcaaagacctatcatctttctaagaacatgaac
tttattggtcttgctggccgtggaggcggactatcagagaaggtatctgtaaaacgccgt
tgggttcacaagatctctaaagaccttccgttagatgaagctgcactgattgagcctttg
agtgtcggttatcatgcagttgagcgcgccggagaaatcaaagacggtgactttgcgcta
gttactggtgctggccccattggcctgcttacctccgccgtacttaaagctaagggggcg
aaggtcattatctctgagctgtcctcgctacgccgtcagaaagcattggattctggagtt
gcagactatgccttctcccctgctgaggttgatgtcctagcagaaattcataagctgacc
gatgataagggtgtagacgtagcctttgaatgcacctctgtacagcctgcactagacctc
attctggatgcactcaagcctaccggtaaagccgtgatcgtatcaatctggggtaaacca
gcatcgttggatgttcagaaggtcgtgcttaaggagcttgatattcgaggaaccattgca
tatgtgaacagccacccggaaactatcaagcttgtagagtcaggcaagattaacctcaag
ccgttcattactggcaggattcctcttgaagacctcattgacaagggatttgatacattg
attaaccacaacgagactgccgtaaagatcctcgtcactaccgatccgcagcttttgccc
tag

DBGET integrated database retrieval system