KEGG   Roseateles depolymerans: RD2015_1393Help
Entry
RD2015_1393       CDS       T04166                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00071  Fatty acid degradation
rdp00072  Synthesis and degradation of ketone bodies
rdp00280  Valine, leucine and isoleucine degradation
rdp00310  Lysine degradation
rdp00362  Benzoate degradation
rdp00380  Tryptophan metabolism
rdp00620  Pyruvate metabolism
rdp00630  Glyoxylate and dicarboxylate metabolism
rdp00640  Propanoate metabolism
rdp00650  Butanoate metabolism
rdp00900  Terpenoid backbone biosynthesis
rdp01100  Metabolic pathways
rdp01110  Biosynthesis of secondary metabolites
rdp01120  Microbial metabolism in diverse environments
rdp01130  Biosynthesis of antibiotics
rdp01200  Carbon metabolism
rdp01212  Fatty acid metabolism
rdp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD2015_1393
   00630 Glyoxylate and dicarboxylate metabolism
    RD2015_1393
   00640 Propanoate metabolism
    RD2015_1393
   00650 Butanoate metabolism
    RD2015_1393
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RD2015_1393
   00072 Synthesis and degradation of ketone bodies
    RD2015_1393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RD2015_1393
   00310 Lysine degradation
    RD2015_1393
   00380 Tryptophan metabolism
    RD2015_1393
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RD2015_1393
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RD2015_1393
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RD2015_1393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rdp04147]
    RD2015_1393
Enzymes [BR:rdp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RD2015_1393
Exosome [BR:rdp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RD2015_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALV05883
UniProt: A0A0U3N0X8
Position
1624797..1625972
Genome map
AA seq 391 aa AA seqDB search
MSNALIVSTARTPLAKSWKGSFNMTHGATLGGHVVRAAVERAGIEPGEVEDVLMGCATPE
GATGSNIARQIALRAGLPVSVSGMTINRFCSSGLQTIATAAQRIIAGEGDVFVAGGVESI
SCVQNEANRHMIHEGWLSQHKPEIYWSMLQTAENVAQRYKIPKERMDHYGAGSQQKACAA
QAEGLFNAEIVPITVTRGVADKVRGMITQEATVSIDEGLRVGTTYESIKDIRTAVPGGVV
TAGNASQFSDGAGACAVVSEAYAQRKGLKPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLK
RLGLTVADIDLWELNEAFAVQVLYCADTLGIPMDRLNVNGGAIALGHPYGVSGQRLTGHA
LIEGKRRGAKRVCVTMCIGGGMGAAGVFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcactgatcgtgtccacggcccgcaccccgctggccaagagctggaaaggc
tccttcaacatgacccatggcgccacgctcggcggccatgtggtgcgcgccgcggtggag
cgcgccggcatcgagccgggcgaggtggaagatgtgctgatgggctgcgccacgcccgaa
ggcgccaccggcagcaacatcgcccgccagatcgcgctgcgggccggtctgccggtgtcg
gtgtccggcatgaccatcaaccgcttctgctccagcggcctgcagaccatcgccaccgcg
gcccagcgcatcatcgccggcgagggcgatgtgtttgtcgccggcggtgtggagagcatc
tcctgcgtgcagaacgaggccaaccggcacatgatccatgaaggctggctgtcgcagcac
aagcccgagatctactggtccatgctgcagactgccgagaacgtcgcccagcgctacaag
attccgaaggagcgcatggaccactacggcgccggcagccagcagaaagcctgtgcggcc
caggccgaagggctgttcaatgccgagatcgtgcccatcaccgtcacccgcggcgtggcc
gacaaggtgcgcggcatgatcacccaggaggccaccgtcagcatcgacgaaggcctgcgc
gtgggcaccacctacgagagcatcaaggacatccgcaccgccgtgcccggcggcgtggtc
acggccggcaatgccagccagttcagcgacggcgccggcgcctgcgccgtggtcagcgaa
gcctatgcgcagcgcaagggcctgaagccgctgggccgtttcctcggctttgcggtggct
ggctgcgagcccgatgaaatgggcatcggtccggtcttcgccgtgcccaaggtgctcaag
cgcctgggcctgacggtggcggacatcgacctgtgggaactcaacgaggcctttgccgtg
caggtgctgtattgcgccgacacgctgggcatccccatggaccgcctcaacgtcaacggc
ggcgcgatcgccctggggcacccctacggtgtctccggccagcgcttgaccggccatgcc
ctgatcgaaggcaagcgccgcggcgccaagcgggtgtgcgtcacgatgtgcatcggcggc
ggcatgggcgctgcgggcgtgtttgaagtgctgtga

DBGET integrated database retrieval system