KEGG   Roseateles depolymerans: RD2015_1664Help
Entry
RD2015_1664       CDS       T04166                                 

Definition
(GenBank) Pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
rdp  Roseateles depolymerans
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rdp03016]
    RD2015_1664
Enzymes [BR:rdp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     RD2015_1664
Transfer RNA biogenesis [BR:rdp03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    RD2015_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ALV06148
UniProt: A0A0U3MW36
Position
complement(1949112..1949906)
Genome map
AA seq 264 aa AA seqDB search
MTSRPPSLPDASLPDVSLPGGSPEAPAPRVPLTLLHLDDHLAVIDKPAGLLVHRTTLDAH
EDDAALQRLRDQLGRPVWPVHRLDRGTSGVLVFALQAEVASQLGVALSERLTHKRYLALV
RGWPAQDRGTVDHPLARDPELPSAGQPMLDAQTHWECLQRFTVPVSTHPQFPDTRLSLLA
CEPVQGRRHQIRRHLKHLAHPIVGDANHGKGPLNRTLAAHLGVQRMWLHALTLRLQHPVT
GAPLTLEAPPGPEWARWLPPAAAR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcgtccgccttcacttcccgacgcttcgcttcccgacgtttcgcttccaggc
ggttcgccggaggcgcccgcgccacgggtgcccctgaccctgctgcacctggacgaccac
ctggccgtcatcgacaagccggccggtctgctggtgcaccgcaccacgctggatgcccac
gaggacgacgccgccctgcagcgcctgcgggatcagctcggccgaccggtctggccggtg
caccgcctcgaccggggtacctccggcgtgctggtgtttgcgctgcaagcggaggtggcc
agccagctcggcgtggcgctgtccgagcgcctgacccacaagcgctacctggcgctggtg
cgcggctggcccgcccaggaccgcggcacggtcgaccatccgctggcccgggatcccgag
ctgccatcggccgggcaaccgatgctggacgcacagacccactgggaatgcctgcagcgt
ttcaccgtgccggtgtccacccatccgcagttcccggacacccggctgagcctgctcgcc
tgcgagccggtgcagggccgtcgtcatcagatccggcgacatctcaagcacctggcccac
ccgatcgtcggggatgccaaccacggcaaggggccgctcaaccgcaccctggctgcccac
ctcggcgtgcagcggatgtggctgcatgcgctgaccctgcgcctgcagcatccggtgacc
ggcgcgcccctgaccctggaagcgcccccggggcccgagtgggcgcggtggctgccgccc
gccgccgcgcgctga

DBGET integrated database retrieval system