KEGG   Roseateles depolymerans: RD2015_3626Help
Entry
RD2015_3626       CDS       T04166                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rdp  Roseateles depolymerans
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RD2015_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ALV08081
UniProt: A0A0U2U7W7
Position
complement(4226180..4227190)
Genome map
AA seq 336 aa AA seqDB search
MGTMQVAFWVVAMLVVLALLFDFMNGFHDAANSIATVVSTGVLKPQQAVLFAAFFNVVAV
AFFELKVAATIGKGSIAPGIVDHHVIFGALIGAISWNVITWLYGIPSSSSHALIGGLVGA
AIAKAGTNGLVMSGIGKTVLFIFVSPLLGFVLGSLLMVIVAWLFRRSSPLRVDNWFRRLQ
LVSAGLYSLGHGGNDAQKTIGLIWMLLIASGYASGTDHSPPTWVIGACYLAIGLGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGAITLFLANGLGIPVSTTHTITGAIVGVGSTQRAS
SVRWGVAGNIVWAWIFTIPASAFIGGVFYWLSFTLF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgatgcaggtggccttctgggtcgtggccatgctcgtggtgctggccttgctg
ttcgacttcatgaacggctttcacgatgcggcgaactccatcgccaccgtcgtgtccacc
ggggtgctcaagccgcagcaggcggtgctgttcgccgccttcttcaacgtggtggcagtg
gccttcttcgaactgaaggtggcggccaccatcggcaagggcagcattgcgccgggcatc
gtggatcaccatgtgatcttcggtgcgctgatcggggcgatctcctggaacgtcattacc
tggctgtatggcattccgtcgagctcgtcccacgcgctgatcggcgggctggtgggcgcg
gccatcgccaaggccggcaccaacggcctggtcatgagcggcattggcaagacggtgctg
ttcatcttcgtgtcgccgctgctgggctttgtgctgggctcgctgctgatggtgatcgtg
gcgtggctcttccggcgcagctcgccgctgcgggtggacaactggttccggcggctgcag
ctggtgtccgcgggcctgtacagcctggggcatggcggcaatgatgcgcagaagaccatc
ggtctgatctggatgctgctgatcgcctccggttatgcctccggcaccgaccattcgccg
cccacctgggtgatcggcgcgtgttacctggccatcggcctgggcacgatgttcggcggc
tggcggatcgtgcggaccatgggtcagaagatcaccaagctcaagccggtcggcggcttc
tgcgccgaaacgggcggggcgatcaccctgttcctggccaatggcctgggcattccggtc
tccaccacccacaccatcaccggcgccatcgtcggggtgggctccacgcagcgggcgtct
tcggtgcgctggggcgtggccggcaacatcgtctgggcctggatcttcaccatcccggcg
tcggccttcatcggtggtgtcttctactggctgagtttcacgctgttctga

DBGET integrated database retrieval system