KEGG   Roseateles depolymerans: RD2015_4139Help
Entry
RD2015_4139       CDS       T04166                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00564  Glycerophospholipid metabolism
rdp01100  Metabolic pathways
rdp01110  Biosynthesis of secondary metabolites
Module
rdp_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RD2015_4139
Enzymes [BR:rdp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     RD2015_4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ALV08588
UniProt: A0A0U3MM91
Position
complement(4812564..4813451)
Genome map
AA seq 295 aa AA seqDB search
MSMKLASWRDRLTQQEQLNFLLTNRVPRLALTRFMGWYSRIESPGLTRLSVAVWRLFTDL
DLSEAEPRAYRSLREVFTRRLRPGVRPVDADPGVLVSPCDAIVGAFGRVERGMALQAKGM
AYGIQELFGDAQRAAPYLNGSYLTLRLTSSMYHRFHAPADLTIERVTHLAGDTWNVNPIA
LKRVERLFCRNVRAAIETRLPDGTPIALVPVAAILVASLRLHALDLTLRPDHPGPHRFDC
RHSHTRGEEMGWFEQGSTIIVFLPPGVALLDGVSTGQRLRMGQAIARLPGTSADG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaattggcgagctggcgtgatcgtttgacccagcaggaacagctgaacttc
ctgctcaccaaccgggtgccccggctggcgctgacccggttcatgggctggtacagccgc
atcgagagccccgggctcacccggctgtcggtggcggtctggcggctgttcaccgacctg
gacctgagcgaagcggaaccacgcgcctaccgcagcctgcgggaggtgttcacccggcgc
ctgcgtccgggcgtccgtccggtggatgccgatcccggggtgctggtgagcccgtgtgat
gcgatcgtgggggcgttcggccgggtcgagcgcggcatggcgctgcaggccaaaggcatg
gcctacggcatccaggagctgttcggcgatgcgcagcgggcggcgccctacttgaacggc
agctacctgacgctgcggctcacctcgtcgatgtaccaccgcttccatgccccggccgac
ctcaccatcgagcgagtcacccatctggccggcgacacctggaatgtgaatccgattgcg
ctcaagcgggtggagcggctgttctgccgcaatgtccgggcggcgatcgaaacccgtctg
ccggacggcacccccatcgccctggtgccggtggccgccatcctggtggccagcctgcgg
ctgcatgcgctggacctgacgctgcggccggaccatcccggtccgcatcggttcgactgt
cgccattcgcatacacgcggcgaggaaatgggctggttcgagcaaggctcgacgatcatc
gtgttcctgccgcccggcgtggcgctgctggacggggtgagcaccggccagcggctgcgc
atggggcaggcgattgctcgtcttcctggaacctccgctgatggctga

DBGET integrated database retrieval system