KEGG   Roseateles depolymerans: RD2015_656Help
Entry
RD2015_656        CDS       T04166                                 

Definition
(GenBank) Methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00670  One carbon pool by folate
rdp01100  Metabolic pathways
rdp01120  Microbial metabolism in diverse environments
rdp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RD2015_656
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     RD2015_656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ALV05152
UniProt: A0A0U3N9E1
Position
complement(741880..742719)
Genome map
AA seq 279 aa AA seqDB search
MSTPVSIEFFPPNTPVGSEKLKTVVQELRAVNPQYFSVTYGAGGSTREKTLATVAEIARQ
GFDAAPHLSCVGSTRENIAEILATYRAQNIRRVVALRGDLPSGTATAGEFRYAAELVRFI
RETQGADWDIEVAAYPEYHPQQRYAARDLQFFADKMKAGASGAITQFFYNPDAYFHFVDA
ARALGVDAPIVPGIMPINNYARIAQFAQRDGIEIPRWVALKMEGYMDDAASVRAFGLDVV
TRLCERLIAGGVPGLHFYTLNQSALTLELCSRLKLSSEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacctgtcagcatcgagtttttcccgcccaacacgccagtgggcagcgagaag
ctcaagaccgtggtgcaggaactgcgtgcggtgaacccgcagtatttcagcgtcacctac
ggcgctggtggatcgacgcgcgagaagacgctggccaccgtggccgagatcgcccggcag
ggcttcgacgcggcgccgcacctgtcctgcgtgggctccacccgcgagaacatcgccgag
atcctggccacctaccgcgcccagaacatccgccgcgtggtggccctgcgcggcgacttg
cccagcggcaccgctaccgccggcgagttccgctatgccgccgagctggtgcgcttcatc
cgcgagacgcagggcgccgactgggacatcgaagtcgcggcctatcccgaatatcacccg
cagcagcgctacgccgcccgggacctgcagttcttcgccgacaagatgaaggccggcgcc
agcggcgccatcacgcagttcttctacaaccctgatgcctacttccatttcgtggatgcg
gcacgtgcgctgggggtggacgcgccgatcgtgccgggcatcatgccgatcaacaactac
gcccgcattgcgcagttcgcgcagcgcgacggcatcgagattccgcgctgggtggccctg
aagatggaaggctacatggacgatgccgcgtcggtgcgcgccttcggcctggacgtggtc
acccggctgtgcgagcggctgatcgccggcggcgtgccggggctgcacttctacacgctc
aaccagtcggcgttgacgctggagttgtgttcgcgcctcaagttgtcatcggagctttga

DBGET integrated database retrieval system