KEGG   Rhodococcus erythropolis BG43: XU06_04490Help
Entry
XU06_04490        CDS       T03842                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00520  Amino sugar and nucleotide sugar metabolism
reb01100  Metabolic pathways
reb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XU06_04490
Enzymes [BR:reb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     XU06_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AKD96123
Position
970480..971664
Genome map
AA seq 394 aa AA seqDB search
MTLRGQILRGQLVTGGRLLSDGVVEISGDRVVWAGPASQRTDPLPERAAAGTTIIPGLVD
VHCHGAGGFGFPEADEFGSTVAADHHRTNGTTSVIGSLVSAPPQILRSRIELLAGLVDEG
TLAGIHLEGPFLSVLRCGAQDPDSILDGDPALLESLLEAGRGRIRSMTIAPETAHFDELA
SLLERHGAVVSIGHTDASNPIATRSIAHSAHAPLSATHLFNGMAPMHHRAPGAVAACLAA
AAKGQMVVELVGDGVHLADETVATVFDLVGPHQIALVSDAMAAAGMPDGRYPLGPLDVDV
VGGVARLAGQGETAIAGGTSRLMDIVRRAVNHAGVDLLSAVIAATATPASLMGLAGMVGD
LVPGCRADLIVTGPELETRAVMAAGNWLMNYTES
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgacacttcgtggacaaattctgcgtggacaattggtgaccggtggtcgattgctctcg
gacggggttgtcgagatctccggtgatcgtgtggtgtgggccggacccgcgtcgcagcga
accgacccgttacccgaacgggcagctgcgggaacaacgatcattccgggtttggtcgac
gttcactgccacggcgccggcggattcggtttccccgaggcagacgagttcggatccacc
gtggctgccgatcaccatcggacgaacggcacgacctcggtgatcggctcgctcgtctcc
gcgccgccgcagatcctgcgcagtcgcatcgagctcctggcaggactggtggacgagggc
acgctggccggaattcacctggaaggtccattcctttcggtacttcgttgtggcgcccag
gatcccgacagcattctcgacggcgacccggctctgctcgagtcgctgctcgaagccggc
cgtgggcgcattcgctcgatgacgatcgctccggagacagcacacttcgacgaacttgcc
tcattgctggagcgtcacggtgccgtcgtgagtatcggacacaccgatgcgtccaacccg
attgcgacacgttcgatcgcacactcggcgcatgcaccgctcagtgccactcacctgttc
aacggtatggcgccgatgcatcaccgtgctcccggcgcagtggcggcatgtcttgccgcg
gctgcgaaaggacagatggtggtcgagttggtcggggacggagtacatctggccgacgag
acggtagcgacggtgttcgatcttgtcggtccgcatcagatcgcgttggtctccgacgcg
atggctgccgccggaatgcccgacggccgttacccgctcgggcctctcgacgtcgacgtg
gtcggtggcgtggcgcgattggccggccagggggaaacggccattgccggcgggacgagt
cggttgatggacatagtccgccgggctgtcaatcacgccggcgtcgatctgctttcggct
gtcatcgcagcgacggcaacgcctgcttcgctgatggggctggccggaatggtcggcgat
ctcgtgccgggttgccgcgccgatctgatcgtcaccggtccagaactcgaaacccgcgcc
gtcatggccgctgggaactggctcatgaactacaccgaaagctga

DBGET integrated database retrieval system