KEGG   Rhodococcus erythropolis BG43: XU06_08190Help
Entry
XU06_08190        CDS       T03842                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00860  Porphyrin and chlorophyll metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
Module
reb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XU06_08190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:reb01007]
    XU06_08190
Enzymes [BR:reb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     XU06_08190
Amino acid related enzymes [BR:reb01007]
 Aminotransferase (transaminase)
  Class III
   XU06_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKE00515
Position
1763433..1764758
Genome map
AA seq 441 aa AA seqDB search
MTVSSGDPDVHATNSARLFERAGNVIPGGVNSPVRAFGSVGGTPRFIREASGYTLTDVDG
NNYVDLVSSWGPMILGHAHPAVVEAVREAALGGLSFGAPTEGEVALAEEIVARVAPVEKV
RLVNSGTEATMSAVRLARGFTGRTKIIKFSGCYHGHVDALLADAGSGLATFGLPTSPGVT
GAQAEDTIVVRYNDLDAVAAAFAANPGAIACVITEAAAGNMGAVAPLPGFNEGLRRLTRE
HGALLIMDEVMTGFRVSTSGWYGIDNVAGDLYTFGKVMSGGLPAAAFGGRADIMGHLAPD
GPVYQAGTLSGNPVAVAAGLASLRAADAEVYAKLGRNATALGDLMTQALTAEGVEHRVQY
AGTLVSVFFTENTVTNYDEAKAAQTWRFPAFFHALLSRGVYPPPSAFEAWFVSAALDDRA
FSIIADAMPHAAKAAAAAVKP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgtcttccggtgatcccgacgtgcatgcaacgaactccgctcggctcttcgaa
cgtgccggcaacgtgattccgggtggcgtcaactcgcccgtccgcgcgttcggttcggtc
ggcggaacaccgcgattcattcgcgaagcatccggctacaccctcaccgacgtcgacgga
aacaactacgtcgacctggtgtcgtcctggggtccgatgattctcgggcacgctcacccg
gcagtcgtcgaagccgttcgcgaagcagcgctcggcggtctctccttcggtgcgccgacc
gaaggcgaagttgccctcgccgaggaaatcgtcgcccgcgtcgcgcccgtggaaaaggtt
cgcctggtcaactccggaaccgaagccacgatgagcgcagtccgcctcgcccgcggattc
accggacgcaccaagatcatcaagttctccggttgctaccacggccacgtcgacgccctt
ctcgccgacgccggatcgggcctcgcgacgttcgggctgccgacctcacccggcgtgacc
ggcgctcaagccgaagacaccatcgtcgtccgctacaacgatctagatgcagtcgccgcg
gcgttcgccgccaaccccggcgccatcgcgtgcgtcatcaccgaagctgccgccggaaac
atgggcgccgtcgcaccgcttcccggtttcaacgagggtctgcgtcgtctcacccgtgag
cacggcgcactcctgatcatggacgaggtgatgacgggattccgcgtcagcacctcgggt
tggtacggcatcgacaacgtcgcaggcgacctctacaccttcggcaaggtcatgagcggc
ggcctgcctgccgcagcattcggcggccgcgccgacatcatgggtcacctcgcgccggac
ggtcccgtctaccaggccggcaccctctcgggtaacccagtggccgtcgccgccggactc
gcgagtctgcgcgccgccgacgccgaggtgtacgccaagctcggccggaacgcgaccgcc
ctcggcgacctcatgacccaagccctcaccgccgaaggcgtcgaacaccgtgtgcagtac
gccggaaccttggtgagcgtgttcttcaccgagaacacggtgaccaactacgacgaagcc
aaagccgcgcagacctggcgattccccgccttcttccacgcgttgctctcccgcggcgtg
tacccgccgccgagcgcgttcgaagcgtggttcgtctccgctgcactcgacgatcgagca
ttctcgatcatcgccgacgccatgccgcacgccgccaaggccgcagctgctgccgtcaag
ccctga

DBGET integrated database retrieval system