KEGG   Rhodococcus erythropolis BG43: XU06_12145Help
Entry
XU06_12145        CDS       T03842                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00020  Citrate cycle (TCA cycle)
reb00620  Pyruvate metabolism
reb01100  Metabolic pathways
reb01110  Biosynthesis of secondary metabolites
reb01120  Microbial metabolism in diverse environments
reb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XU06_12145
   00620 Pyruvate metabolism
    XU06_12145
Enzymes [BR:reb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     XU06_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKE00635
Position
2629341..2630819
Genome map
AA seq 492 aa AA seqDB search
MSATLGALLRQLQPDWSISTFERLDAVAAESSDPWNNAGTGHSALCELNYTPENSDGTVD
IKKAVNVNEQFQVSRQFWAHAVEQGVLTQPKEFINPIPHVSFVHGEANAKYLRARYDALA
GHTLFRGMEYIDDPAEFSERLPLMAKGRDFSDPIALNWSQDGTDVDFGALTKQLIGYIGK
TGGKMYFGHEVTNLTQNSDKSWTVKVTNRRTGEKRTVRSRFVFVGAGGGALHLLQKSGIK
EAKGFGGFPVSGAFLRCTNPELIDQHSAKVYGKAAVGAPPMSVPHLDTRVIGNKPGLLFG
PYAGWSPKFLKQGRVTDLPGSVKPNNILSMLGVGVSELGLVKYLVSELAKNEAGRIWDLR
EFAPKAQAQDWELITAGQRVQVIRRAKGKGGVLEFGTAVVAAEDGSIAGLLGASPGASTA
VPAMLDVLERCFPTEFQGWKGKLREMVPSIGVKLTDNEGLFNQVWDWSSKVLELDSAGAS
ESAPVADTVATV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacgctgggtgcattgctgcgccagctgcagcccgattggtcgatctcgacc
ttcgagcggctcgatgccgtcgcagccgagagcagcgacccctggaacaacgcgggaacc
ggtcactccgccctgtgtgagctcaattacaccccggagaactccgacggcacggtcgac
atcaagaaggccgtcaacgtcaacgagcagttccaggtgtcccgccagttctgggcacac
gcggtcgagcagggcgtcctgactcagcccaaggaattcatcaaccccatcccacacgtg
agcttcgttcacggtgaggccaacgccaagtacctgcgtgctcgctacgacgcacttgcc
ggccacacgctcttccgcggcatggagtacatcgacgatccggccgagttcagcgagcgt
ttgccgctcatggccaagggacgcgacttctccgatcccatcgccctgaactggagccag
gacggcaccgacgtcgatttcggagcgctcaccaagcagctcatcggctacatcggtaag
accggcggcaagatgtacttcggccacgaggtcaccaacctgacccagaactcggacaag
tcctggaccgtcaaggtcaccaaccgtcgcaccggcgaaaagcgcaccgttcgctcgcgc
ttcgtgttcgtcggtgctggtggcggcgccctgcacctgctgcagaagtccggcatcaag
gaagccaagggcttcggtggcttcccggtcagcggtgctttcctgcgatgcaccaacccc
gaactcatcgaccagcacagcgccaaggtttacggcaaggctgccgtcggcgccccgccc
atgtcggtgccgcacctcgacacccgtgtcatcggcaacaagccgggtctgctgttcggc
ccgtacgccggatggtcgccgaagttcctcaagcagggtcgcgtcacggacctgcccggc
tcggtcaagccgaacaacatcctctcgatgctcggcgtcggcgtcagcgagctcggcctg
gtcaagtacctggtcagcgaactcgccaagaacgaagccggtcgcatctgggatctgcgt
gaattcgcgcccaaggcgcaggctcaggactgggagctcatcaccgcgggccagcgcgtc
caggtgatccgccgtgccaagggcaagggcggcgtcctcgaattcggtaccgctgtggtc
gccgctgaggacggctccatcgccggcctgctcggcgcttcgcccggtgcgtccacggcc
gtcccggcgatgctggacgtactcgagcgctgcttcccgaccgagttccagggttggaag
ggcaagcttcgcgagatggttccgtccatcggcgtcaaactcaccgacaacgaaggcctg
ttcaaccaggtctgggattggtcctcgaaggttctcgagctcgattccgctggtgcttcc
gaatcggctccggtcgcggataccgtcgcgactgtgtga

DBGET integrated database retrieval system